Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G008490-GRMZM2G358238
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.51576871864039
Log2 mRNA fold difference:0.60645194163057
Log2 TE fold difference:-0.087504341558167
Sequences
Protein sequence

MTRRPCGLWLYTLSMVDESSARILSTAALKRRADASGAHTQSHSHQQTASAPPTNPNYSI
PHRRPHLAVQCSPSGSRQAPSSSIAGCSKASESETELTSLTPSLLHLPHALMRRKKHLDR
GGGGRGGGTELFICFTSRPSAASAAPVAGGSAQSSLRPSSSSKLLSPGRGSASASGAETV
PAPPLHPSLSRRLRNSGSLKGGQSPMFPSGSTGGGRRSRGGFEPAEPSSPKVTCIGQVRV
KGGKRKPKHTSAATLHSCSRRGGVGSAEVSFRRAGDDRDGPQSKNQGWVYQIPVNICEAL
KTFGSCGGRSLCSPSRHGGAGERGALPTDANCGKKRRQGAPAGGSWLCGAAVARCLLAIQ
EEDDDEVGNGKGAAVVPAEEMRTSEVGLVMEGWDVEEEKAVMMGDVEVEKKDEILVVGKE
EEGRVSVCIPPRNALLLMRCRSDPVRMAALATRFWGSPAAATVEQVDNEVAGCLNDNEEE
EEKEEEAEAEPLECKDGARCSAVSVKDLKCEECGSDENDGAEAGEINQEKAEAEESSKCG
DLVEEKEGASCRVGVEEAQIVRKDAELEVPLGEVTEMENQGPDMVELVVSEEEVPGHEKV
DEEMMGRRSINSYSPSATLKEDRTKLRRLSSRMCVSTSSRASSSSDRVGRRHSFSAEMEA
RRSSFSSLKDSRRASFSIDRDGRRWSFSIEQEHLVAQPKVLMASRKGKKTSSEAESEKDC
DVVAPNSAEEGQESYDDGKEEDTTENVAEEGKTKSAEANQEVEKVETRAEECEGGTVPVI
HRRKKSGELPDCLLLMMYEPKLSMEVSKETWVCSTDFVHWKSYQGKNNRNHWQQKASAAG
TVETKEKENAEGTTIANDVQESKDPSTVNSAVPMPCPVVQKTPPLKPATTEQKLKLELPP
VTNAAAYAPFVLKRCKSEPMRSSARLAPDACFWKDRHRPLNAAGVGF*

MRRKKHLDRVGGGGGGGTELFICFTSRSSAASATSVAGVSAHSSLRPSSSSKLLSPGRGS
ASASGAEAVPAPPLHPSLSRRLRNSGSLKGGQSPMFPSGSTGGGRRGRGGFEPAEPSSPK
VTCIGQVRVKGGKRKPKHASAAALRSRSRRGGGGSAEASFRRAGDDREGPQGKNQGWVHQ
IPVNICEALKTFGSCGGRSLCSSSRPGEAGEWGALSTDAHRGKKRGQRAPAGGSWLCGAA
VARCLLAIQEEEDDDEVGKGAAVVPAEEMRASDGWDVEEEKTVMVGEVEVEKKDEILVVG
KEEEGRVSVCIPPRNALLLMRCRSDPVRMAALATRFCGSPAAATVEQVDNEVSGCLNDNE
EEGKEEAGAEAEPVECKDEAHGSVVSVTDLKCEECGCDENGGAETDEIDQAKTEAEESSK
CGDLMEEKEDASCRDLVGVEEAQIVRKNAGLEVSLGEVTETENQGLDMVVSEEEVPAQEE
VEDKMKGRRSISSYSPSAALKEDRTKLRRWSSRRRGNTSSRASSSSDRVGRRHSFSAETE
ARRSSFSSFKDSRRASFTIDRDGRRWSFSIEQEHLVAEPKVLMASRKGKKTSSEPESEKD
CVVVAPNSVEEGQESCDDGKEEETTENAEGEGKTHYSEINQEVEKVETRAEECEGGAGPV
IQRRKKSGELPDCLMLMMYEPKLSMEVSKETWVCSTDFVHWKSYQGKNNYNHRQQKAFAT
GTVETVKKENADGSTVVKDVQESKDPSTVNSAVPMPCPVVQNTLALKPATTEQTPKLELP
PVTNAAAYAPFVLKRCKSEPMRSSARLAPDACFWKDRHLPLNATGVGF*

Other information
Ka divergence:0.178216KaKs divergence:0.328453
GC content 1 (%):57GC content 2 (%):57GC content divergence:0
Length 1 (bp):2844Length 2 (bp):2487Length divergence:-0.067
MFE 1 (kcal):-1160.93MFE 2 (kcal):-1014.72MFE divergence-0.067