Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G008712-GRMZM2G079067
Species:maize
Duplication type:WGD
Function (paralog1):zinc finger protein 7
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.05051362475147
Log2 mRNA fold difference:-1.6175400585071
Log2 TE fold difference:0
Sequences
Protein sequence

MERVPGVEEQKSADQVNQAGLADESTTVPWLKLGLDAPKSEEVKPQEAKPVATPHRTFSC
NYCMRKFFSSQALGGHQNAHKRERCAARRTYRLQMMMGLPPSASFLQPLRVNSHSTILKG
HGERAAVAVARFDGGQMSGWMPFAVEEPGGLVWPGSFTASSDESKKQMEKNLDLTLRL*

MDRVPDGVEEHKSAADQANEAGLADDSTAVPWLKLGLDAPKSEEAKPPREVKPVATPHRT
FSCNYCMRKFFSSQALGGHQNAHKRERCAARKPYRFQMMTGLNPPSDSFLQPLRVNSHST
ILKDHGESAAAAVVARFDGGPMSSWMPFAIEEPGGLVWTGSFTASSEESKKQIEQKNIDL
TLRL*

Other information
Ka divergence:0.162744KaKs divergence:-0.0913515
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):537Length 2 (bp):555Length divergence:0.016
MFE 1 (kcal):-183.98MFE 2 (kcal):-194.8MFE divergence0.029