Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G008728-GRMZM2G162007
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284272
Function (paralog2):hypothetical protein LOC100216678

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRMRAVVITCAGGPEVLEAREVEDHPALGEGEVLLEVAAAGVNRADTVQRMGRYPPPAGA
SPYPGLECSGTILALGPNVPSRWAVGDKVCALLSGGGYADKVVAPAGQLLPIPEGVSLTH
AAGLPEVACTVWSTVFMTSHLSPGESFLIHGGSSGIGTFAIQIAKHLGIKVFVTAGSEEK
LAACKALGADVCINYRTEDFVERIKQETNGKGVDVILDNIGGSYLQRNLNSLGVDGRLFI
IGFQGGIAAEVNLQAVLARRLTIQAAGLRNRSLANKAEIVSEVEKNVWPAVAAGKVKPVI
YKTFPLCEAAEAHRLMEASTHIGKILLLP*

MHRLVHRLHEVMTSHLSPGESFLIHGGSSGIGTFAIQIAKHLGIMVFVTAGTEEKLAACK
GLGADVCINYKTEDFVERVKQETNGKGVDVILDNIGGPYLERNLNSLGVDGRLFIIGFQG
GAVAEVNLQAVFAWRLTIQAAGLRGRSAASKTQIVSEVEKNVWPAVAAGKVNPVIYKTFP
LSEAADAHRLIESSMHIGKILLLP*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):57GC content 2 (%):50GC content divergence:-0.065
Length 1 (bp):990Length 2 (bp):615Length divergence:-0.234
MFE 1 (kcal):-429.7MFE 2 (kcal):-196.9MFE divergence-0.372