Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G008748-GRMZM2G024647
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100191612
Function (paralog2):60S ribosomal protein L6

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.018987785495341
Log2 mRNA fold difference:-0.055362135830087
Log2 TE fold difference:0.037515935985937
Sequences
Protein sequence

MAPTSKLSTGIKRASRSHAYHRRGLWAIKAKNGGAFPKADKAAAAVEPKFYPADDVKPRV
PSTRKPKPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLISGPFKINGVPIRRV
NQTYVIATSTKVDISGVDVAKFDDKYFAREKKQKVKKTEGELFETEKEASKSLPDFKKDD
QKAVDSALIKAIEAVPELKTYLGARFSLRDGDKPHEMVF*

MAPTSKLSTGIKRASRSHTYHRRGLWAIKAKNGGAFPKADKAAAAVEPKFYPADDVKPRV
PSTRKPKPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLISGPFKINGVPIRRV
NQTYVIATSTKVDISGVDVAKFDDKYFAREKKQKVKKTEGELFETEKEASKSLPDFKKDD
QKAVDSALIKAIEAVLELKTYLGARFSLRDGDKPHEMVF*

Other information
Ka divergence:1KaKs divergence:0.998361
GC content 1 (%):57GC content 2 (%):56GC content divergence:-0.009
Length 1 (bp):660Length 2 (bp):660Length divergence:0
MFE 1 (kcal):-245.41MFE 2 (kcal):-241.41MFE divergence-0.008