Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G008864-GRMZM2G023254
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100382262
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.0568462411353
Log2 mRNA fold difference:2.6870123541676
Log2 TE fold difference:-0.6460325493666
Sequences
Protein sequence

MKILVAVKRVVDYAVKVRVRPDRTGVETANVKMSMNPFCEIAVEEALRLREAGAAAEVVA
ATVGPAQSAETLRTALANGADRAIHVLHDPDPARPLLPLTVAKILRAVALQEKPGLVILG
KQAIDDDCNQTGQMLAGLLQWPQGTFASKVILDTEKQKATVEREVDGGIETICLDLPAVI
TTDLRLNQPRYATLPNIMKAKSKVIKKVVPKDLGVDIRSDMEVIEVNEPPKRKAGVILSS
VDELIDRLKNEARVL*

LIWQVILDTEKQKATVEREVDGGIETICLDLPAVITTDLRLNQPRYATLPNIMKAKSKVI
KKVVPKDLGVDIRSDMEVIEVNEPPKRKAGVILSSVDELIDRLKNEARVL*

Other information
Ka divergence:1KaKs divergence:0.996059
GC content 1 (%):56GC content 2 (%):42GC content divergence:-0.143
Length 1 (bp):768Length 2 (bp):333Length divergence:-0.395
MFE 1 (kcal):-291.5MFE 2 (kcal):-89.8MFE divergence-0.529