Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G009223-GRMZM2G125850
Species:maize
Duplication type:WGD
Function (paralog1):glucose-6-phosphate/phosphate translocator 2
Function (paralog2):hypothetical protein LOC100279907

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MLASAATVKPSTAAAAATCKAAFKPLHLPPLPAAAGLRPLSLSVSARPLYRQEHVLASVA
VAAAGRNERATSPAPPSATADGARPLEVAAPAETGRRAKIGVYFATWWALNVIFNIYNKK
VLNAFPYPWLTSTLSLAAGSAIMLASWATRIAEAPQTDLDFWKALTPVAIAHTIGHVAAT
VSMAKVAVSFTHIIKSGEPAFSVLVSRFFLGEHFPAPVYFSLLPIIGGCALAAVTELNFN
MVGFMGAMISNLAFVVRTIFSKKGMKGKSVSGMNYYACLSIMSLVILLPFAVAMEGPKVW
AAGWQTAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIVAS
IIIFQTPVQPINALGAAIAILGTFIYSQAKQ*

MQAAAASVKSSPPRRRLQAAVPLRLRASAVPPRPCPRDNRGDGGGGPQRPRRVPRASVRH
SGRRPAGGGGRRAGGDRAPRQDRGVLRHVVGAERDLQHLQQEGAERVPVPVAHVDAVPRR
RLRHHARVLGHQDRRGAPDGPRLLEGAHSRCDRAHDRARRGDGEHGQGGRVVHAHHQERG
AGIQRARLQVLPRRALPGAGLLLPPPDHRWVRARRRHRAQLQHGWVHGGNDLEPGVRRPD
HLLQEGDEGQVRERDELLRLPLHHVAGDPPPLRRRHGGTQALGGGLAASSRRDRPQLRLV
GGCAERVLPPVQPGVVHVAGRDLAAHVLHRQHHEEDLRHRRLHHHLPDARPAHQRARSRH
RHPRNLHLLPGKAVTPCINWRLDGLPSSVHRGSARCSKMTAYDL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):66GC content 2 (%):65GC content divergence:-0.008
Length 1 (bp):1176Length 2 (bp):1215Length divergence:0.016
MFE 1 (kcal):-520.39MFE 2 (kcal):-528.84MFE divergence0.008