Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G009320-GRMZM2G128072
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278234
Function (paralog2):hypothetical protein LOC100275810

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.7758582184115
Log2 mRNA fold difference:-1.7878893325103
Log2 TE fold difference:0.018093017935111
Sequences
Protein sequence

MAPQPLRAPRLSAPAGHAACRCSAAPLFGKRAPPVVAFPRARSGGAVASCSAVQESSTST
TGTGLATLIAGWVGSLLNKFSRDVDRHVSKKKDAADGAKEATAEAAKPAAAAKPKKAAAL
PLPEMMQQEIIPPLKDALEAEDDVSQVQLAFQNNTLEGSFIKNDVPYYFWAFFPKGDLTG
PKGFALSSYSNEVSTIEPFLIDEKRITAKYVVFWVYKRLAGQGILPVWKEEEGEEEAAK*

MVMAPQPSRALSPRLSRAPGAGHASCRCSAALAPLFGKRPAPLVVSFPRAGSGGAVASCS
AVPVQESSTSTAVSKKKDGANKEATAAKPKKAAALPLPEMMQEEIIPPLKAALEAEEDVS
QVQLAFENNTLEGSFIKDDVPYCFWAFFPKGDLTGPKGFALSSYSNEVSTIEPFLIDEKR
VTAKYVVFWVYKRLAGQGILPVWKEEEGEDHQDAK*

www.000webhost.com

Other information
Ka divergence:0.6274KaKs divergence:0.226648
GC content 1 (%):63GC content 2 (%):64GC content divergence:0.008
Length 1 (bp):720Length 2 (bp):648Length divergence:-0.053
MFE 1 (kcal):-325.4MFE 2 (kcal):-300MFE divergence-0.041