Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G009412-GRMZM2G125527
Species:maize
Duplication type:WGD
Function (paralog1):60S ribosomal protein L44
Function (paralog2):60S ribosomal protein L44

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.51590871266994
Log2 mRNA fold difference:-0.34997568921083
Log2 TE fold difference:0.8557781448589
Sequences
Protein sequence

MVNVPKTKKTYCKNKECKKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHK
KAKTTKKIVLKLQCQSCKHYSQHAIKRCKHFEIGGDKKGKGTSLF*

MRVFRLVNVPKTKKTYCKNKECKKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTK
PVFHKKAKTTKKIVLKLQCQSCKHYSQHAIKRCKHFEIGGDKKGKGTSLF*

Other information
Ka divergence:1KaKs divergence:0.979381
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):318Length 2 (bp):333Length divergence:0.023
MFE 1 (kcal):-86.82MFE 2 (kcal):-102.11MFE divergence0.081