Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G009479-GRMZM2G015419
Species:maize
Duplication type:WGD
Function (paralog1):lipoxygenase11
Function (paralog2):lipoxygenase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:3.9417900956244
Log2 mRNA fold difference:6.0575888068227
Log2 TE fold difference:-2.0195786095614
Sequences
Protein sequence

MIQMNMKQPLVLPAHRGNVIGSRLASSPSPVAAAAAAASRRRGVVSSPRSRLQRHMRLPR
ISCSATEEASGAVSAVTVEKMLTVTASVQAAPAIGQMYFQRALDDAGDFFGKTLLMELVS
SEVDAKTGLEKPRVTAFAHKTLREGHYEAEFKVPASFGPVGAVLLENEHHKEIFIREIKL
VTGSDSSTAVTFGCNSWVHSKFDNPEKRIFFTLKSYLPSDTPKGLEDLRKKDLQALRGDG
HGERKASERVYDYDVYNDLGDPDKNPAHQRPVLGGSKRYPYPRRCRTGRPRTRKDPEAEV
RHGHNYVPRDEQFSEVKQLTFGATTLRSGLHALLPAIRPMLIKRELRFPHFPAIDDLYSD
GIPLPAQTGLGAIRSIVPRVVKLVEDTTEHVLRFELPDMIERDRFSWFKDEEFARQTIAG
LNPLCIQLLTEFPIRSKLDPEVYGPAESAITKEILEKHMSGGAAMTVEQALAAKRLFILD
YHDVFLPYVHRVRELPDTTLYGSRTVFFLTDLGTLMPLAIELVRPKSPTQPQWKRVFTHG
PDATDAWLWKLAKAHVVTHDTGYHQLVSHWLRTHCCVEPYIIAANRQLSRLHPVYRLLHP
HFRYTMEINALAREALINADGIIEESFWPGRYAVELSSAAYGATWQFDTEALPNDLVKRG
LAVRRDDGELELTIKDYPYAHDGLMVWNTIRQWAADYVNVYYKSDEAVAADPELKAFWDE
VRNVGHGDKKDEPWWPVLDTRDSLAETLTTIMWVTSGHHSAVNFGQYHFGGYFPNRPTTI
RKSMPVEEEAGRDEEMKKFLKQPETTLLDMLPTQMQAIRVMTTLDILSSHSPDEEYMGEL
AEPSWLEEPMVKAAFEKFGGRMKEIEGFIDECNNNPELRNRCGAGIVPYELLKPFSKPGV
TGRGIPNSISI*

MMNLNLKQPLVLPAHHSNVVGSRLSSSSPSAAAASRRTGGGVSSRSGSRRHVRLPRISCS
ATEEVSGAVSSVTVERMLTVTASVEASPAIGQMYFQRAVDDIGDLLGKTLLLELVSSELD
AKSGVEKTRVTAYAHKTLREGHYEAEFKVPASFGPVGAVLVENEHHKEVFIKEIKLVTGG
DSSTAVTFDCNSWVHSKFDNPEKRIFFTLKSYLPSDTPKGLEDLRKKDLQALRGDGHGER
KVFERVYDYDVYNDLGDPDKNPAHQRPVLGGNKQYPYPRRCRTGRPRTKKDPETEMREGH
NYVPRDEQFSEVKQLTFGATTLRSGLHALLPALRPLLINKKDLRFPHFPAIDDLFSDGIP
LPAQTGFDAIRTVVPRMVKLVEDTTDHVLRFEVPEMIERDRFSWFKDEEFARQTIAGLNP
LCIQLLTEFPIKSKLDPEVYGPAESAITKEILEKQMNGALTVEQALAAKRLFILDYHDVF
LPYVHKVRELQDATLYASRTIFFLTDLGTLMPLAIELTRPKSPTRPQWKRAFTHGPDATD
AWLWKLAKAHVLTHDTGYHQLVSHWLRTHCCVEPYIIAANRQLSRLHPVYRLLHPHFRYT
MEINALAREALINADGIIEESFWPGKYAVELSSVAYGATWQFDTEALPNDLIKRGLAVRG
EDGELELTIKDYPYAHDGLLVWDSIRQWASEYVNVYYKSDEAVAADPELRAFWDEVRNVG
HGDKKDEPWWPVLDTRDSLVETLTTIMWVTSGHHSAVNFGQYHFAGYFPNRPTTIRKNMP
VEEGGPGEEMEKFLKQPETTLLDMLPTQMQAIKVMTTLDILSSHSPDEEYMGEFAEPSWL
AEPMVKAAFEKFGGRMKEIEGFIDECNNNLDLKNRCGAGIVPYELLKPFSKPGVTGRGIP
SSISI*

Other information
Ka divergence:0.154856KaKs divergence:0.897041
GC content 1 (%):67GC content 2 (%):67GC content divergence:0
Length 1 (bp):2736Length 2 (bp):2718Length divergence:-0.003
MFE 1 (kcal):-1345.89MFE 2 (kcal):-1314.33MFE divergence-0.012