Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G009661-GRMZM2G049127
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100279734

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.089229402078063
Log2 mRNA fold difference:-0.25930759068546
Log2 TE fold difference:0.17674485429879
Sequences
Protein sequence

MIKQILGRLPKKPTKAGEKELAGAGPSLPSPTSDARTTTDLTASSRLVSPSNYASAATNP
GQSYAPRAAGLGAGASNGFAGSAAGYEALPSFRDVPASEKPGLLLGKLAMCCVVFDFADP
TKDVREKEVKRQTLLELVDYITSATSKFPEPVVQEVVRMVSVNLFRVPTPAPRENKALES
FDMEEEEPVMDPAWSHLQIVYELFLRFIQSPETDAKLAKRYIDHGFIIRLLDLFDSEDPR
EREYLKTILHRIYGKFMVHRPFIRKAINNIFYRFIFETEKHNGIAELLEILGSIINGFAL
PLKEEHKLFLVRALIPLHKPKCVAMYHQQLSYCVTQFVEKDCKLADTVIRGLLKYWPITN
SSKEVMFLGELEEVLEATQPAEFQRCMVPLFRQIARCLSSSHFQVAERALFLWNNDHIEG
LIKQNNKVILPIIFPALERNTKGHWNQAVQSLSLNVRKIFMDHDPALFEECHKKFEEEEA
QEAGVSVGFIIIGQRKGGKMVFFRVNVLIQGLLGALERRGRRQVALALADGDFAEM*

MIKQILGRLPKKQAKSGEKELAGAGPSLPSPTADTRTTTDLTTSSRLVSPSNYASTATNQ
GQSFVAARAAGVSNGFPASAGYEALPSFRDVPAPEKPGLFLRKLAMCCVVFDFADPTKDA
REKEVKRQTLLELVDYITSATGKFPEHVVPEVIRMVSANLFRVPPPAPRENKALELFDME
EEEPVMDPAWPHLQIVYELFLRFIQSPETDAKLAKRYIDHGFIVRLLDLFDSEDPREREY
LKTILHRIYGKFMVHRPFIRKAINNIFYRFIFETEKHNGIAELLEIFGSIINGFALPLKE
EHKLFLVRSLIPLHKPKCVAMYHQQLSYCVTQFVEKDCKLADIVIRGLLKYWPVTNSSKE
VMFLGELEEVLEATQPAEFQRCMVPLFRQISRCLSSSHFQVAERALFLWNSNHIEGLIKH
NSKVILPVVLPALERNTKGHWNQAVQSLSLNVRKIFMDYDPALFEECREKFEEEEAQEAG
MRSRCEARWKRLEEIASSKEVK*

Other information
Ka divergence:-0.0149519KaKs divergence:0.0455894
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):1611Length 2 (bp):1509Length divergence:-0.033
MFE 1 (kcal):-599.48MFE 2 (kcal):-552.31MFE divergence-0.041