Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G009717-GRMZM2G157631
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):F-box domain containing protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.48503903942736
Log2 mRNA fold difference:0.019572016511076
Log2 TE fold difference:0.44135181691354
Sequences
Protein sequence

MSEDPVGSRRWRCDLGGDERWLSGAAGDDQFDRLPDALLLVIFNRIGDVKALGRCSLVSR
RFHELVPLVDSVLVRVDCVIPDEPPSSSSSSSTPSSPTASVRARGVFSQIARIVLGGIVK
PIQALGQILSPANSASGFPASAASSLSSSSSSSSPLPAGDVSHHSPSEVLRSFKELRHLR
IELPAGELGMDDGVMLKWKADFGSTLGSCVILGASSASPSPSPSSAGSDSPSAAPSDDSG
HTEPDECDDSGSIPESFYTNGGFKLRVVWSISSLIAAAARHYLLQPIIADHMTLETLDLT
DADGQGVLTMDKCQLQELRVRPVSTSRGSHRTLMPELCMWLWYAPCIELPGGLLLNGATL
VAIKPSEEGTGDTVWNETADAAWVLDAFEEPYRTAAKMLLKRRTYSLEMNSF*

MSEDPACSRRSRCDLGGDERWLSGPAGDDHFDRLPDALLLVIFNRIGDVKALGRCSLVSL
RFHELVPLVDSVLVRVDCVIPDEPPSSSSPSTPFSPTASVRARGVFSQIARIVLGGIVKP
IQALGQILSPANSASGFPASSDSSPSSSSSSLPLPLADVSHHSPSEVLRSFKELRHLRIE
LPAGELDMDDGVMLKWKADFGSTLGSCVILGASSASASASVSPSSADSDSTSTAPSVDGG
RTEPDECVDSGSIPESFYTNGGFKLRVVWTISSLIAAAARHYLLQPIIADHKTLERLDLT
DADGQGVLTMDKCQLQELRVRPLSTSRGSHRTLMPELSMWLWYAPCIELPGGLVLNGATL
VAIKPSEEGTWDTVWNGAAGAAWVLDAFEEPYRTAVRMLLKQRTYSLEMNSF*

Other information
Ka divergence:0.0524389KaKs divergence:-0.160119
GC content 1 (%):61GC content 2 (%):62GC content divergence:0.008
Length 1 (bp):1239Length 2 (bp):1239Length divergence:0
MFE 1 (kcal):-513.12MFE 2 (kcal):-516.52MFE divergence0.003