Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G009843-GRMZM2G171987
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381954
Function (paralog2):ATP binding protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.32997013173659
Log2 mRNA fold difference:0.86369531359548
Log2 TE fold difference:-0.50594234083472
Sequences
Protein sequence

MAEAAAAGSLSRRRMQDEEGAAAGSLSRRRMQDEEGAAAIEADAGHRRRSEAEEAEDDVE
SSDYMSEDEGTEDYRRGGYHAVRVGDSFKQGTYVVQSKLGWGHFSTVWLAWDEAHSRYVA
LKVQKSAQHYTEAAMDEIKILKEIADGDPDDSKCVVKLLDHFKHSGPNGNHVCMVFEFLG
DNLLTLIKYTDYRGIPLSMVKEICRHVLIGLDYLHRTLSIIHTDLKPENILLVSTIDPLK
DPRRSGVPLLLPSESTDEPPPKVPAQSGNGGLTKNQKKKIRRKAKRAAAATSDGTSAVAS
ADTDGSDDQGDMGTTNEGSSGTMKRATRDRRGSKGAKKMAMEADLKCKLVDFGNACWTYK
QFTNDIQTRQYRCPEVILGSKYSTSADMWSFACICFELTTGDVLFDPHSGDNFDRDEDHL
ALMMELLGMMPRKIALGGRYSRDFFNRYGDLRHIRRLRFWPLNKVLMEKYEFTEINAHGM
ADFLVPILDFVPEKRPTAAQLLQHPWLDVGPLRQQPKTLPDSAQNSDDGVSEKQKKESEE
REAMALELGNIAIDGAGGK*

MSEAEAAGSLSRRRMEDEEGAAAMEADAAHSGRGEAEDEEVESSDYTSEDEGTEDYRRGG
YHAVRVGDSFKQGAYVVQYKLGWGHFSTVWLAWDTVHSRYVALKVQKSAQHYTEAAMDEV
KILKQIADGDPDDSKCVVKLLDHFKHSGPNGNHVCMVFEFLGDNLLTLIKYTDYRGIPLP
MVKEICRHVLIGLDYLHRTLSIIHTDLKPENILLVSTIDPTKDPRKSGVPLVPPSMRTDE
PPPKVPAQSGNGGLTKNQKKKIRKKAKRAVAATSEGSSAVASADTDGSDDRGDLGTTNEG
SPRQDGAKKRVTRDRRGSKGAKKMMAMKADLKCKLVDFGNACWTYKQFTNDIQTRQYRCP
EVILGSKYSTSADMWSFACICFELATGDVLFDPHSGDNFDRDEDHLALMMELLGMMPRKI
ALGGRYSRDFFNRYGDLRHIRRLRFWPLNKVLMEKYEFTEINANGMADFLVPILDFVPEK
RPTAAQLLQHPWLDVGPLRQQPKTRPESARSPGDGVSEKQKKEKEEREAMAVELGNIAID
GASSRMANDPQSSTNKTTATSSKK*

Other information
Ka divergence:-0.247161KaKs divergence:-0.332192
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):1680Length 2 (bp):1695Length divergence:0.004
MFE 1 (kcal):-579.01MFE 2 (kcal):-573.9MFE divergence-0.004