Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G009895-GRMZM2G147046
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216616
Function (paralog2):hypothetical protein LOC100273391

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.92880099763797
Log2 mRNA fold difference:0.79838085904447
Log2 TE fold difference:-1.7210246391863
Sequences
Protein sequence

MARWRPAALLVVALTAVLSAARRADALSVTVTDTECIHEFVPYEGDTVSGNFVVVDHDIF
WSSDHPGIDLTVTSPGGNTVHTLKGKSGDKFEFKAPKGGMYKFCFHNPYGAPETVSFYIH
VGHIPNEHNLAKDEHLDPINVKIAELKEVLESVTAEQKYLKAREARHRHTNESTRKRVMF
YTMAEYIAFVAASTLQVLYIRRMFSKNVGYNRV*

MARWRPAALLVVALAAVLSAAWRADALSVTVTDTECIHEFVPYEGDTVSGNFVVVDHDIF
WSSDHPGIDLTVTSPGGNTVYTLKGKSGEKFEFKAPRGGMYKFCFHNPYGAPETVSFYIH
VGHIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAREARHRHTNESTRKRVMF
YTMAEYLAFMAASALQVLYIRRLFSKNVGYNRV*

Other information
Ka divergence:-0.60189KaKs divergence:-0.586777
GC content 1 (%):53GC content 2 (%):53GC content divergence:0
Length 1 (bp):642Length 2 (bp):642Length divergence:0
MFE 1 (kcal):-223.6MFE 2 (kcal):-227.2MFE divergence0.008