Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G009901-GRMZM2G025164
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381620
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.46965022678984
Log2 mRNA fold difference:-0.53910092972846
Log2 TE fold difference:0.053900739030567
Sequences
Protein sequence

MRDFPSCFGESGVQIADASSSSSSSAGKGAAQNLVTCLYQTHFSGRPCVISLTWSKSLMG
QGLSVGVDDLSSGHCLCKADIKPWLFSKKKGSRSLDVEDGKVEIFWDLSGARFGAGPEPV
EGFYVAVVFDLELALLLGDMKKDAYRKTGASQSTLNAAAFVARREHIYGKKIYSAKAQFC
DNGQFHDIAIECDTVGFKDPCLEIRVDKKPVMQVKRLAWKFRGNQAILVDGLPVEVFWDV
HSWLFGSTASNAVFMFQTRQAPEKSLPWSYSQNFRESQLQGLGFSLILHAWKVE*

MRDFPSCFGESGVQIADASSSSSSAGKGAAQNLVTCLYQTQFSGRPCVISLTWSRSLMGQ
GLSVGVDDLSGHCLCKADIKPWLFSKKKGSKSLDVEDGKIDIFWDLSGAKFGAGPEPVEG
FYVAVVFDLELVLLLGDMKKDAYRKTGANRSMLNAAFVARREHIYGKKTYSAKAQFCDNG
QFHDIVIDCDTVDLKDPCLEIRVDKKPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSW
LFGSTASNAVFMFQTCQAPEKSLPWSYSQIFRESQLQGLGFSLILHAWKLE*

Other information
Ka divergence:-0.453361KaKs divergence:0.195244
GC content 1 (%):61GC content 2 (%):60GC content divergence:-0.008
Length 1 (bp):885Length 2 (bp):876Length divergence:-0.005
MFE 1 (kcal):-397.64MFE 2 (kcal):-378.4MFE divergence-0.025