Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G010000-GRMZM2G031637
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.23106912688992
Log2 mRNA fold difference:-0.18179468773552
Log2 TE fold difference:-0.12713025480716
Sequences
Protein sequence

MAVSSPSSAPEKKRKWLLSNRKVTDKYLREARKILAAAPECGGGDAVAALGLVDAALELS
PRMEAALELRARALLALRRYREVAEMLRDYIPSCGKSCSGEDTSSSSSASLLSTGSGDLG
TISRAKLLSPDRHRSDDAEPDARPVRSFRCFDISELKRRVLAGLSKNPNTDTQWRYLVLG
QACFHLGLIEDAMVLLQTGRRLASAAFRRESVCWSDDSFSSSSSSSATAAAPCVPSGKTS
SSGWAFIIPATESEAVSQLLAHVKLLLRRRAAAMAALDAGLPAEAVRHFSKILEARRGVL
PHPFAAACLVGRAAAFQASGRPADAIADCNRALALDPAYIPALRARADLLQSVGALADCL
RDLDHLKLLYDAALRDGKLPGPRWRPQGGVRYREISGAHRKLTARIQGLRGRVAAGEACN
IDYYLLLGVRRGCTRSELERAHLLLSLKLKPDRAVVFGERLELVDEHRDLEAVRDQARMS
ALLLYRMLQKGYSFVMSAVLDEEAAERQRAKDAAAAAAAAAAALAAKQEAPKQEPPPPVP
EKSENTESGRPRSPPPPGRAQTAKPKPKPKAKAATTTATMPKAAAAVTSTAPVYQGVFCR
DMAVVGTLLSRGGGFDRALPVKCEAMSC*

MAVSSAPEKKRKWLLSYRKVIDKYLREARRILAAAPEGGGGGDAAAALGLVDAALELSPR
MEAALELRARALLALRRYREVAEMLRDYIPSCGKSCSGEDTSSSSSASLLSTGSGDLGTI
SRAKLLSPDRHRSDDAEPDARPVRFFRCFDVSELKRRVLAGLSKNPNTDTQWRYLVLGQA
CFHLGLIEDAMVLLQTGRRLASAAFRRESVCWSDDSFSSSSATAAAAPSVPSGKTSKSSS
AFFIIPATESEAVSQLLAHVKLLLRRRAAAMAALDAGLPAEAVRHFTKILEARRGVLPHP
FAAACLVGRAAAFQAGGRPADAIADCNRSLALDPAYIPALRARADLLQSVGAVADCLRDL
DHLKLLYDAALRDGKLPGPRWRPQGGVRYCEIAGAHRKLTARIQGLRGRVAAGEACNIDY
YLLLGVRHGCPRSELERAHLLLSLKLKPDRAVVFGERLELVDEHRDLEAVRDQARMSALL
LYRMLQKGYSFVMSAVLDEEAAERQRAKDAAAAAAALAAKQEAATQEPPQPVPGKSKNTE
SGSGRPRSPPGRAQTAKPKPKSKAKAKSATAATMPKAPAAVNSTAPVYQGVFCRDMAVVG
TLLSRGGAFDRALPVKCEAMSC*

www.000webhost.com

Other information
Ka divergence:0.0886351KaKs divergence:-0.158485
GC content 1 (%):71GC content 2 (%):70GC content divergence:-0.007
Length 1 (bp):1887Length 2 (bp):1869Length divergence:-0.005
MFE 1 (kcal):-999.66MFE 2 (kcal):-985.64MFE divergence-0.007