Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G010054-GRMZM2G149406
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384351
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.5309886500118
Log2 mRNA fold difference:-0.21149008879512
Log2 TE fold difference:-0.30371042253783
Sequences
Protein sequence

MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH
ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE
VDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP
EMNLLAAGHDSGMIVFKLERERPAFCVSGDTVFYLKDRFLRFFEYSTQKEVQVAPIRRPG
SVSLNQSPRTLSYSPTENAVLICSDADGGSYELYIVPKDSAGRSDYLQEAKKGAGGSAVF
VARNRFAVLEKSSNQVLVKNLKNEILKKSPLPIATDAIYYAGTGNLLCKGEDRVAIFDLQ
QRLVLGELQTPAIKYVVWSSDMESVALLSKHAVVIASKKLVHKCTLHETIRVKSGAWDEN
GVFIYTTLNHMKYCLPNGDSGIIKTLDVPIYITRVVGNNIFCLDRDGKNKLIAVDASEYI
FKLALLRKRYDHVMSMIKNSQLCGQAVISYLQQKGFPEVALHFVKDEKTRFNLALESGNI
QIAVASAKEIDDKDHWYKLGIEALRQGNVGIVEYAYQRTKNFERLAFLYLITGYLDKVGF
MCKIAGQNNNLMGQFHNALYLGDAKKRVEILENAGQLPLAYVTAVTHGLTEIAERIASEL
GENVPSLPEGKSHSLLIPPAPLTACGDWPLLRVVRGIFEGGLDATGRADLEEDDEAAGAD
WGDEDLDIVDVSEVVANGGDGVDVEEGEPNEEDGEEGGWDLEDLELPPETETPKAVGNAR
SALFVAPTPGIPVSQIWTQRSSLAGEQAAAGNFDTAMRLLSRQLGIKNFVPLKPLFIDLH
MGSHTYMCAFAAAPVISVAVEKGWNESASPNVRGPPALVFSFSQMEDRLKAAYKATTEGK
FPEALRQFLSILHTIPVIVVDSRREVDEVKELIEIVREYVLGLRMELKRKELRDDVTRQQ
ELAAYFTNCKLQRVHMRLVLASAMALCFKQKNYATAAHFARMLLENSPQEAQAKKARQVL
QACQDKDDSHQLNYDFRNPFVVCGATYVPIYRGQKDVSCPYCGSRFVPSIEGQLCTICEL
GAVGADASGLLCSPTQSR*

MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH
ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
NWQSRTCVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDILR
LTQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWE
VDTLRGHVNNVSCVMFHAKQDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP
EMNLLAAGHDSGMIVFKLERERPAFCVSGDTVFYVKDRFLRFFEYSTQKEVQVAPIRRPG
SVSLNQSPRMLSYSPTENAVLICSDADGGSYELYIVPKDSAGRSDYLQEAKKGAGSSAVF
VARNRFAVLEKSSNQVLVKNLKNEIVKKSPLPIATDAIYYAGTGNLLCKAEDRVAIFDLQ
QRLVLGELQTPAIKYVVWSSDMESVALLSKHAVVIATKKLVHRCTLHETIRVKSGAWDEN
GVFIYTTLNHMKYCLPNGDSGIIKTIDVPIYITRVVGNNIFCLDRDGKNKLVAVDASEYI
FKLALLRKRYDHVMSMIKNSQLCGQAVISYLQQKGFPEVALHFVKDEKTRFNLALESGNI
QIAVASAKEIDDKDHWYKLGIEALRQGNVGIVEYAYQRTKNFERLAFLYLITGYLDKVGF
MCKIAGQNNNLMGQFHNALYLGDAKKRVEILENAGQLPLAYVTAATHGLTEFAERIAAEL
GENVPSLPEGKPKSLLIPPAPLTACGDWPLLRVMRGIFEGGLDATGRADLEEDDEAAGAD
WGDEELDIVDASEVVANGDGFDVEEGEPNEEGGEEGGWDLEDLELPPETETPKAVGNARS
ALFVAPTPGIPVSQIWTQRSSLAGEQAAAGNFDTAMRLLSRQLGIKNFVPLMPLFLDLHM
GSHTYLRGLAAAPVISVAVEKGWNESASPNVRGPPALVFSFSRMEDRLKAAYKATTEGKF
PEALRQFLSILHTIPVIVVDSRREVDEVKELIEIVREYVLGLRMELKRKELRDDVTRQQE
LAAYFTNCKLQRVHMRLVLASAMALCFKQKNYATAAHFARMLLENSPQEAQAKKARQVLQ
ACHDKDDSHQLNYDFRNPFVVCGATYVPIYRGQKDVSCPYCGSRFVPSIEGQLCTICELA
AVGADASGLLCSPTQSR*

Other information
Ka divergence:0.10511KaKs divergence:-0.0583501
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):3657Length 2 (bp):3654Length divergence:0
MFE 1 (kcal):-1264.01MFE 2 (kcal):-1265.39MFE divergence0.001