Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G010257-GRMZM2G075630
Species:maize
Duplication type:WGD
Function (paralog1):60S acidic ribosomal protein P2APutative uncharacterized protein ;
Function (paralog2):60S acidic ribosomal protein P2APutative uncharacterized protein ;

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.6389056642828
Log2 mRNA fold difference:2.0221800044181
Log2 TE fold difference:-0.37724427154426
Sequences
Protein sequence

MKFVAAYLLAVLAGNSSPSAEDLTAILESVGCEVDNEKMELLLSQLSGKDITELIAAGRE
KFASVPCGGGGGMAVAAAGPAAGGAAPAAEAKKEEKVEEKEESDDDMGFSLFD*

MKFVAAYLLAVLAGNSSPSAEDLTAILESVGCEVDNEKMELLLSQLSGKDITELIAAGRE
KFASVPCGGGGVAVVAAAPAAGGAPAAEAKKEEKVEEKEESDDDMGFSLFD*

Other information
Ka divergence:-0.343635KaKs divergence:-0.0329041
GC content 1 (%):57GC content 2 (%):55GC content divergence:-0.018
Length 1 (bp):342Length 2 (bp):336Length divergence:-0.009
MFE 1 (kcal):-142.4MFE 2 (kcal):-134.1MFE divergence-0.03