Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G010302-GRMZM2G055970
Species:maize
Duplication type:WGD
Function (paralog1):DIP1
Function (paralog2):nucleic acid binding protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.3057960473275
Log2 mRNA fold difference:0.59513168891198
Log2 TE fold difference:1.7330611397103
Sequences
Protein sequence

MSTSPAAADVSPLPPTAAADEAARATETVVVDERVASHVDPFLVEALDNPRHRLMVLRME
LDIQNFMQNPQLQEFEFQNFPTSYLRCAAHRVAQHYGLETIVADSLVEGSVSRIVARKTA
ESRYPAIFLSEVPSNQARNDHETAEKLKFVIYQRPKAFQNGSADSRNKSGVPKTVDERIE
EYNKARARIFNGSISADSDAASIMGTLSTGKDEPVNVDPSVDETKVSTMNSRSRVAVFKD
TEKDRSDPDYDRNYKRYVRSSVPGFNLSPGVFNFVVPQFMQYDIGYVQSPGMSTNQHTMY
FGQPDLTIGSSGAAVYRHWPTPTMMYPHCYDNVSPMMSQVPLYQSFNHD*

MSTSPAASAAASPPPPIASAAEASRATETLVVDERVASHVDPFLVEALDNPRHRLMVLRM
ELDIRNFMQNPQLQEFEFQNFPTSYLRCAAHRVAQHYGLETIVADSLVEGSVSRIVARKT
PESRCPAISLAEVPSKQARNDHEAAEKLKFVIYQRPKAFQNGSTDLGNKNGAPKTVEERI
EEYNKARARIFNGSVSADSDAASVLGTLCTGRDESVNVEPSVDEIKVSTMNNRSRVAVFK
DTQKDRSDPDYDRNYKRYVRSPVPDFNLSPGAFNFVPQFMQYGVGYVQSPGMSTNQPAVY
FGQPDLTMGSSGAAVYPHWPTPAMMYPHCYDNVGSMISQVPLYQSFNHG*

Other information
Ka divergence:-0.219833KaKs divergence:-0.174825
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):1050Length 2 (bp):1050Length divergence:0
MFE 1 (kcal):-324.27MFE 2 (kcal):-352.47MFE divergence0.042