Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G010435-GRMZM2G340065
Species:maize
Duplication type:WGD
Function (paralog1):cysteine protease 1
Function (paralog2):cysteine protease 1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.17614157726585
Log2 mRNA fold difference:0.2813149965105
Log2 TE fold difference:-0.11184696249185
Sequences
Protein sequence

MGPINLTACRAPESTHRPNRKNRESKRKEQGGGEKRRAKKGKGRTSRHVLHRSTPAVMAA
LGLLLLLLLAVVGAANAAAPGGRMSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAY
NALGERDRRFRVFWDNLRFVDAHNERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPASR
RRGTAVGERYRHGGGAEELPESVDWREKGAVAPVKNQGQCGSCWAFSAVSSVESVNQIVT
GEMVTLSEQELVECSTDGGNSGCNGGLMDAAFDFIIKNGGIDTEGDYPYKAVDGKCDINR
ENAKVVSIDGFEDVPENDEKSLQKAVAHQPVSVAIEAGGREFQLYKAGVFTGTCTTNLDH
GVVAVGYGTENGKDYWIVRNSWGAKWGEDGYIRMERNVNATTGKCGIAMMASYPTKKGAN
PPKPSPTPPTPPPPPVAPDNVCDENFSCAAGSTCCCAFGFRNVCLVWGCCPMEGATCCKD
HASCCPPGYPVCNVRAGTCSVSKNSPLSVKALKRTLAKLNSA*

MAALGRGLPLLLLLLLLAVSGAANAAAAPGGMSIITYNEEHGARGLERTEPEVRAMYDLW
LAEHGRAYNALGEGEGERDRRFLVFWDNLRFVDAHNERAGARGFRLGMNQFADLTNDEFR
AAYLGAMVPAARRGAVVGERYRHDGAAEELPESVDWREKGAVAPVKNQGQCGSCWAFSAV
SSVESVNQIVTGEMVTLSEQELVECSTDGGNSGCNGGLMDAAFDFIIKNGGIDTEDDYPY
RAVDGKCDMNRKNARVVSIDGFEDVPENDEKSLQKAVAHQPVSVAIEAGGREFQLYKSGV
FSGSCTTNLDHGVVAVGYGAENGKDYWIVRNSWGPKWGEAGYIRMERNVNASTGKCGIAM
MASYPTKKGANPPRPSPTPPTPPAAPDNVCDENFSCSAGSTCCCAFGFRNVCLVWGCCPV
EGATCCKDHASCCPPGYPVCNVRAGTCSVSKNSPLSVKALKRTLAKLSTA*

Other information
Ka divergence:-0.146695KaKs divergence:-0.400424
GC content 1 (%):61GC content 2 (%):65GC content divergence:0.032
Length 1 (bp):1569Length 2 (bp):1413Length divergence:-0.052
MFE 1 (kcal):-690.3MFE 2 (kcal):-670.9MFE divergence-0.014