Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G010637-GRMZM2G368678
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAAAEQLKELGEKLQAVAPAPADELAKLLEKAVECLRGIEQSPGSSVMEAIQPSLKAVTR
EELLKHEDDNVKVLLATCFCEITRITAPDAPYNDDILRDIFYLIVGTFGGLSDVNSQSFG
RRVAILETVARYRACVVMLDLECDDLITNMFQTFLGVVSDSHEENIVKSMQAIMILIIDE
SEDVQESLLRVLLSALGQKKTGAAMSARKLARSVIEHSATKLEPYIKKFLTSSWAGNGSS
SNDQIDHQGVVFDLYQCAPKVLKAIVPYITGELLADEVDNRSKSVELLGEIFSLPGASIV
ECFKTLFTEFLKRLTDRVVEIRISVVEYLKRCLISNPSRAEAPEIIKALCDRLLDYEENV
RKGVVAALCDVATHSPYAIPIDTIKVVAERVRDKSQAVKCYTMERLADIYKLYCQRDSDS
STNSDDFEWIPGKILRCLYDKEFRPESIDSILSGSLFSPEYQMKGRVKHWITAATYFDKV
EMKALEQILLHKQRLQQEMLKYISLREPSQEDAPDLQKRIFGCFRNISRLFSDSAKCEEN
LNMLHQLKDADFWKIFTSLLNCSTTFEKAWSLRAELLKILGENHVLYNFVGTLTMRCSYL
LVNKEYAKEILAEASAQKTSGNTKLISSCMNLLTAISSFFPSLLAGLEEDIVELLKEDNE
VLKEGIAHVLSKAGVNIREQLASTSSLDLLLERLCLEGTRRQAKYSVHALAAITKDDGLM
SLSVLYKRLVDLLEEKKVNIPSILQSLGCIAQIAMPIFETRKEEILSFIIKKILDCNDDM
VQNSSNKSEWGDSTHNCLLKIYGIKTLVKSYIPCKDAHAQPGIEKLIDILKNILTYGDIS
PNMVSSAADKAHLRLAAAKAVLRLSKQWDHKVPVDVFYLTLRISQDDFPQVRKLFLCKVL
QYIKERALDAKYACAFMFGVNDYHGPQLEEFKYNLTEVVQICQQVKMRQLSVQADMNLLT
AYPEYIISFLVHALAHDPSSPDIEEHENVKAFGPTYWRLYLILSILLGEEGLQHSVPGMK
KDSFTTIISIFKSIKSSQDVVDGNKNKTLWAICDLGTLIAKRLCQDQTSLSEAQTVPLPP
QLYAPLQDNQNENSVESYGQIWPGCEKVLAHFEAVMTANMDKVESPKHKMLIDMTDEFGN
EVPLGKIVKLLKLRGEKKAEKKQKAPSSSSVNAENDDDVLGLVREINLSNQEDLEELQKG
KPKKRQTDTKNSNKKPLDFSSPKRKRSISKSRPHSAKGSKNSDDRLIHTPNTERTSISLE
TKLKEKNRDDSIDTELLVSPSIRTPVSKGNKGAKRSHIDILSSVPKKSADAESTKRTVEP
RSLNGSLKSQKSKPISGLVQCSTQDSSGTDLVGHRIKVWWPLDKRFYEGTVQSYDSSKKK
HTVLYDDGDVEVLILAKEKWILIESNDSSVKKQKKDLGTNQGRAWEGTSSNKSPPSQPKS
KKRSLPPKKKGQPNDKRRKTAERNNSVEEEGIGAGDNDSDSSSPLAHSDVDKDVNSVGHM
EEVIVSLAEKEKTRKDSKGMEMKEKGGKDSKDVKIKEKAGKESKDVEMKEKIGKESKDVK
IKEKAGKESKDAEVKEKTGKDSKDVETKDKAEKDSKDVEMEEEAGKHSKDVNMKEKAGKE
SKDVEMKEKTGKESKYAKMKEKAGKESKDLEVKEKAGKDSKDVELKHEAGKDSKDVKMKE
KAGKESKDSEMKEKIGKESKDVKMKDKSVKESKDVEMKEKPGKDSKDVKTKEKAGKESKD
LEVKGEAGKESKHGEAKKPGKDSKDVKTKENAAGKESKDAEVKEKAVKDPKDVEMEGMAG
KEPKDVEKLDGHTLSNEESDNDTLSVWKKRTAKAT*

MELPPCSSPPNLASPGSSVAEAAAAGDGDRREQQHAVGKEMSVRIMREGGWCCTCVSHEG
GDAAVLRLCEGEVESPQADHSTQALSCLILVLNSLVMHTCLIEILLLHVLQKAVECLHGI
EQSPVSSVMEAIQPSLKAVTREELLKHEDDNVKVLLATCFCEITRITAPDAPYNDDILRD
IFYLIVGTFGGLNDVNSQSFGRKVAILETVARYRACVVMLDLECDDLITNMFQTFLVVVS
ESHEEYIVKSMQTIMTLIIDESEDVHESLLRVLLSALGQKKTGAAMSARKLACSVIEHSA
TKLEPYLKKFLMSSWAGNVSSSNDQIDHQGVVFDLYQCAPKVLKVIVPYITGELLADEVD
NRSKSVELLGEIFSLPGSPIVECFETLFTEFLKRLTDRVVEIRISVVEYLKRCLISNPSR
AEAPEIIKALCDRLLDYEENVRKGVVAALCDVATHSPDAIPIDTIKVVAERVRDKSLAVK
CYTMERLADIYKLYCQRGFDSSTNSDDFEWIPGKILRCLYDKDFRPESINSILCGSLFPP
EFPMKGRVKHWVTAATYFDKVEMKALEQILLQKQRLQQEMMKYISLRQLSQEDAPDLQKR
IIGCFRNISRLFSDSAKCEENLNMLHQLKDADIWKIFTSLLNCSTTFEKAWSLRADLLKI
FGEKHVLYNFVGALAMGCSYLLVNKEYAKEILSEASEQKTSGNTKLISSCMNLLTAISSF
FPSLLSGLEEDIVELLKEDNEVLKEGIAHVLSKAGGTIREQLASTSSLDLLLERLCLEGT
RRQAKYSVHALAAITKDDGLMSLSVLYKDMVRNSSNKSEWGDSTENCLLKIYGIKTLVKS
YLPCKDAHAQPGIEKLIDILKNILTYGDVSPNMVSSAADKAHLRLAAAKAVLRLSKQWDH
KVPVDVFYLTLRISQDDFPQVRKLFLCKVLQYIKERALDAKYACTFMFGVNDYHAPPYEE
FKYNLTEVVQICQQVKMRQLSVQADMDLLTAYPEYIISFLVHALAHDPSSPEIEEHENVN
AFGPIYWISWIQCILLVSRPFDLGGLGIPNLLTMNWALQIHWLWLQKTAPSKPWSGLDLK
ISPQVRALFQAAVATTIGNGSTTFFWKDRWIHGCCVKDTAPLIVAAVPKKYRDERTVQQA
LTDLTWVQDIQGNLSLTGIEQYLQLWSKGLQKGWSVECVRCAYGGESVCKHWRLYLILSI
LLGEEGLQHSVPGMKKDSFTTIISIFKSIKSSQDVVDGSKTKTVCAICDLGTLIAKRLCQ
DQTSLSEAQTVPLPAQLYTPLHDNQNENSVENNEQIWLGCEKVLAHFEAVRTANMDKVES
PKHKMLIDVTDEFGNEVPLGKIVKLLKSRGERKIGEKQKAPSSSSVNAENDDVLGLVREI
NLNNQEDLEESHKDKSEKRHTNAKDSNQKPLDFSSPKRKRSISKSRPHSAKGSKSSDERL
LHTPNSERTNISLETKMKEKDRDDSTDTELLVSPSTRTPVSKQNKGAKKSNINILSSVPK
KSADADSTKRTVEPRSLNGSLKRQKSKPISGLLKFIPECGVDFKFFVIRFYEGAVQSYDS
SKKKHRGHHVRGQRSERRSVHDRIGPRVGNGDQTNDCSQVLADEAVLVEFSNVEFREVDA
QIQSHGPVVSSCAVSAECSSLQGGGQFSVHECPGSGQLIGCPEELCQIGSQQGGGQISVL
KGPGNGQMNGCHEDYNQIGCQQKSKKTIMKTLGVIHDGDSLSQEALEEYSSIFSNSLSQV
QIQALASLFGWSLPEETLLVEATL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):5508Length 2 (bp):5295Length divergence:-0.02
MFE 1 (kcal):-1589.52MFE 2 (kcal):-1656.89MFE divergence0.021