Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G010831-GRMZM2G124791
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100276070

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.2476166724674
Log2 mRNA fold difference:5.5863821662804
Log2 TE fold difference:-3.3222963091054
Sequences
Protein sequence

MTMTSRFVAAASSSSSSCPLARLISRRGLAGAADGHGPAKVPLWKDPLSPSKWKEEHFVL
ASLSMWGALFYGGFKFFGGKKEDKIEAASGQT*

MYIPQTLETCSRVPDHRRGTKARDNRCVNESIAMASRLVAAAASSSSLSSASPLARLISR
RGLAGAADGHGSAKVPLWKDPLSPSKWKEEHFVLASLSMWGVIFYGGYKLFSGKKEAKTE
AASPQA*

Other information
Ka divergence:-0.0515197KaKs divergence:0.0864557
GC content 1 (%):56GC content 2 (%):57GC content divergence:0.009
Length 1 (bp):279Length 2 (bp):381Length divergence:0.155
MFE 1 (kcal):-91.7MFE 2 (kcal):-128.7MFE divergence0.168