Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G011006-GRMZM2G076683
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193480
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.5243525956148
Log2 mRNA fold difference:-2.9699575837591
Log2 TE fold difference:0.73555000296501
Sequences
Protein sequence

MEAYFLFHSGRAHEFAYAEQEEDIGSPSDSEPPSTSTSRESAGSSAELDDDATSSGSGSG
SDRFEMSALMTQLPPFKRGLSRFFDGKSQSFASLAAVGSLEDLPKPARKRLKPSRSCGGA
LDAHRGRLLSPRRHYCTKPTARTRKAAARSGTLSVLAAGAPRMPPAVARAEGVAAKVLIV
S*

MEAYLFFHSGRAHEVACAEQEEDIGSPSDSESPSTSTSRESAGSSSELDDDASSSGSDRF
EMSALMTQLPLKRGLSRFFDGKSQSFASVAAVGSLEDLAKPARKRLKPSRSCGGALDAHR
GRLLSPRRHWTKPAAASGARKTAARSGGLSVLTAVAPRMPPPVRGLRTWPPRFSSLIEPR
ISLPELDIDARLHVTGCAVAGTATHQRIHPCLN*

www.000webhost.com

Other information
Ka divergence:0.404556KaKs divergence:0.388862
GC content 1 (%):70GC content 2 (%):69GC content divergence:-0.007
Length 1 (bp):546Length 2 (bp):642Length divergence:0.081
MFE 1 (kcal):-274.4MFE 2 (kcal):-312.8MFE divergence0.065