Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G011078-GRMZM2G124918
Species:maize
Duplication type:WGD
Function (paralog1):SC3 protein
Function (paralog2):LOC100285595

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.262917297021
Log2 mRNA fold difference:-1.6249625826759
Log2 TE fold difference:0.35608223796565
Sequences
Protein sequence

MAGRSRYDNPFEEGGADEVNPFADQAKRGGSTAQSGYSGGAFYTTQSQRPAPPSTRLSPL
PPEPADFYNDFATPVDIPMDTNKDMKTREKELLAKEAELNRREKEIKRREDAAARAGIVL
EEKNWPPFFPIIHNDIGNEIPVHLQRTLYVAFASLLGLVLCLFWNIICITAAWAKGSGPK
IWFLAIIYFILGCPGAYYLWYRPLYRAMRNESALKFGWFFLFYLIHIAFCAYAAVSPSIL
FVGKSLTGILPAISLIGDSVIVGIFYFIGFALFCLEALLSVWVIQRVYLYFRGSGKEAEM
RREAARGAARAAF*

MAGRSTYDNPFEEGAAAAEVNPFADQAKRGGPTAQSSYSGGAFYTTSQRPAPPSTRLSPL
APEPAGFYNDFATPVDIPMDDTNNKDRKTREKELLAKEAELNRREKEIKRREDAAARAGV
VLEEKNWPPFFPIIHNDIGNEIPVHLQSTLYVAFASLLGLVVCLFWNIICVTAAWAKGSG
PKIWFLAIIYFILGCPGAYYLWYRPLYRAMRNESALKFGWFFLFYLVHIAFCVYAAVSPS
ILFVGKSLTGIFPAISLIGDSVIVGIFYFIGFALFCLESLLSMCVIQRVYLYFRGSGKEA
EMRREAARSAARAAF*

Other information
Ka divergence:0.25864KaKs divergence:0.298197
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):942Length 2 (bp):948Length divergence:0.003
MFE 1 (kcal):-323.11MFE 2 (kcal):-330.2MFE divergence0.011