Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G011101-GRMZM2G378906
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383446
Function (paralog2):hypothetical protein LOC100383446

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.5611503537607
Log2 mRNA fold difference:1.2173945387248
Log2 TE fold difference:0.34762762483299
Sequences
Protein sequence

MEKPCSLLVHFDKGSAAMANEIKADLEGSDGPAKADAMRRAISLLLNGETLPQLFITIVR
YVLPSEDHTVQKLLLLYLEIIDRRDPAGRALPEMILICQNLRNNLQSPNEYIRGVTLRFL
CRLSEPEVLEPLVPSVLANLEHRHHFIRRHAVSSVSAIYRLPHGDQLIPDAPELVERFLA
SEQDASARRNAFLMLCACAQDRAVAYLLSNADRVAEWPDLLQMAVVDLIRKVCRSQNRAN
KGRYITIITSLLSTPSTAVVYECAGALVSLSSAPTAVRAAANTYCQLLSSQSDNNVKLIL
LDRLNELHTLHRDVMVGVVMDVLRALASPNLDVKRKVLDLVLDLLTPRNVEEVVLYLKKE
VVKTQAGDLEKGGEYRQMLVQAIHACAVEYSEVAGSVVHLLMDFLGDTNVAAAVDVVLFV
REIIETNPKLRVSMIQRLIDTFYQIRASRVCSCALWILGEYSLSLSEVESAIATIKQCLG
DLPFYTVSDEGEATDSAKPAKAVVNSVTVSSRRPVVLADGTYATQSAATETILTPSVAPG
SLASTLNLRSLILSGDFFLAAVVACTLAKLVLRLEEVQPSKVESNKACTGALLIMTSILQ
LGQSSYLPHPIDNDSYDRIVLCVRLLCNTGDDVRKIWLQSCRQSFAKMLAEKQFRETEEM
KAKAQISHAQPDDLIDFYHLKSRKGMSQLELEDEVHDDLKAATGGFTKDADDANKLNRIL
QLTGFSDPVYAEAFVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVDRPQNYTL
APESSKQIRANIKVSSTETGVIFGNIVYETSNVMERSVVVLNDIHIDIMDYISPATCADV
TFRNMWAEFEWENKVAVNTVIQDEKEFLNHIIKSTNMKCLTPPSALDGECGFLAANLYAK
SVFGEDALVNISIEKQHDGKLSGYIRIRSKTQGIALSLGDKITLKQKGGS*

MEKPCSLLVHFDKGSASMANEIKADLEGSDGPAKADAMRRAISLLLNGETLPQLFITIVR
YVLPSEDHTVQKLLLLYLEIIDRRDPAGRALPEMILICQNLRNNLQSPNEYIRGVTLRFL
CRLSEPEVLEPLVPSVLANLEHRHQFIRRHAVSAVSAIYRLPHGDQLIPDAPELVERFLA
SEQDASARRNAFLMLCACAQDRAVAYLLSNADRVAEWPDLLQMAVVDLIRKVCRSQNRAN
KGRYITIITSLLSATSTAVVYECAGALVSLSSAPTAVRAAANTYCQLLSSQSDNNVKLIL
LDRLNELRTLHRDVMVGVVMDVLRALASPNLDVKRKVLDLVLDLLTPRNVEEVVLYLKKE
VVKTQAGDLEKGGEYRQMLVQAIHACAVEYPEVAGSVVHLLMDFLGDTNVAAAVDVVLFV
REIIETNPKLRVSMIQRLIDTFYQIRASRVCSCALWILGEYSLSLSEVESTIATIKQCLG
DLPFYTVSDEGEVTDSTNSAQAVVNTVTVSSRRPVVLADGTYATQSAATETISAPSVAHG
SLASTLNLRSLILSGDFFLAAVVACTLTKLVLRLEEVQPSKVESNKACTGALLIMTSILQ
LGQSSYLPHPIDNDSYDRIVLCLRLLCNTGDDVRKIWLHSCRQSFAKMLAEKQFRETEEM
KAKAQISHAQPDDLIDFYHLKSRKGMSQLELEDEVHDDLKAATGGFTKDADDANKLNRIL
QLTGFSDPVYAEAFVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVDRPQNYTL
APESSKQIRANIKVSSTETGVIFGNIVYETSNVMERSVVVLNDIHIDIMDYISPATCADV
TFRNMWAEFEWENKVAVNTVIQDEKEFLNHIIKSTNMKCLTPPSALDGECGFLAANLYAK
SVFGEDALVNISIEKQHDGKLSGYIRIRSKTQGIALSLGDKITLKQKGGS*

Other information
Ka divergence:0.28351KaKs divergence:0.118173
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):2853Length 2 (bp):2853Length divergence:0
MFE 1 (kcal):-1029.66MFE 2 (kcal):-1026.87MFE divergence-0.001