Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G011173-GRMZM2G348866
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191586
Function (paralog2):hypothetical protein LOC100279265

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.28555941653294
Log2 mRNA fold difference:-0.82091286541386
Log2 TE fold difference:0.52823469786839
Sequences
Protein sequence

MPPPPQLNGGKVTPNLAMDAAATRLLNLTVLQRLDPAVEDILITAAHVTLYDFNIDLNQW
SRKDVEGSLFVVKRNSQPRFQFIVMNRRNTDNLVEDLLSDFEYELQPPYLLYRNASQEVN
GIWFYNQHDCEAVASLFGRILNAYAKVPPKPKVPSTKSEFEELEAVPTSAAIDGPLEPPL
GSTAVVLDTPDEPLINYFSVASSIGSESNAPLSGRVQLATESIPSSHVLLIIPSAAPAHQ
LPPSVASSAPPLPIHDTNAHTSRSTNLVTPDFFAPPPSSSTPLAPPGASVIPTAPPLHPT
SASVQRSQYGAPLLQPFPPPTPPPSLTPAHSERPVVTRDRVKDALQRLVQVKLHTENMQG
TVVWISIILSNSHQMPNRATSSSIWCIGNCRNHLCRLLINPSGVSGS*

MPPQPNGGKVTPNLAMDAEATRLLNLTVLQRLDPAVEDILITAAHVTLYDFNIDLNQWSR
KDVEGSLFVVKRNSQPRFQFIVMNRRNTDNLVEDLLSDFEYELQPPYLLYRNASQEVNGI
WFYNQQDCEAVASLFGRILNAYAKVPPKPKVPSTKSEFEELEAVPTSAAIDGPLEPPPAS
AAVVLDTPDESLISYFSGAASIGSVSNAQPSGRVHPSTESIPSSHVPLIVPSAASTHQLP
PSVASTASPLPVHGTNAHTSRPTNLVTPDFFAPPPSSSAPLAPPGASVVPTAPPLHPTSA
ASIQRSQYGTPLLQPFPPPTPPPSLNPSHSDRLTVTRDRVKDALQRLVQVKIVHTENIQG
TTVLDRYHHFL*

www.000webhost.com

Other information
Ka divergence:0.144971KaKs divergence:0.175518
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):1224Length 2 (bp):1116Length divergence:-0.046
MFE 1 (kcal):-375.63MFE 2 (kcal):-341.56MFE divergence-0.048