Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G011347-GRMZM2G074540
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.476855009334
Log2 mRNA fold difference:-2.0081741361424
Log2 TE fold difference:1.3995698273143
Sequences
Protein sequence

MEFTGTKKDVEMAGQLNTELSSREHALPALLIKVPSQAIAGFDCVPAAADAAVVSLNEPG
DRAEDVAISILPAPARAYGGDAHGVPYSVSLSMPASPSGFHLSSHFMCAGDAPVATADVR
PVLLEDQRQAAAAAHSPRLIKQTRFHSQPILNLHPPSKNVVDEAAARRWDSARDTRFDPF
KTFSGRLERQLSNLRGRPQEPVDGISPDSKISEEETDQVPAADRYFDALEGPELDTLRVS
TKASSLTTCRSGLENQKKKTCLSSKHHDLSSFALQATEVPVLPKDEKWPFLLRFPISAFG
MCLGVSSQAILWKTLASAAPTAFLHVSPAVSHALWYAALALTVLVSGIYLLKVVFYFEAV
RREFYHPIRANFFFAPWIACLFLALGAPRLVAEMHHGVWYALMAPIFCLELKIYGQWMSG
GQRRLSKVANPSNHLSIVGNFVGALLGAKMGLREGPVFFFAVGLAHYMVLFVTLYQRLPT
NMTLPKELHPVFFLFVAAPSVASMAWAKINGQFDAGARIAYFIALFLYMSLAVRINFFRG
FRFSLAWWAYTFPMTGASVAAITYATEVDNVLTRALCIGLSGISTVTVAGLLVTTVFHAF
VLRDLFPNDVSIAITRKKPKFSKILAHFRSSSSDMKELVLSLPRTAQSDSGETETEPSVT
AKSRAEP*

MSFFQHLACVCVHDLMIDGHASHDCGFVSTVCLGVLQVPFLGVTMEFIGSGKDVVKKIQL
VAAGGLSTELPSSSSSRGEGDALPALLVKAPSQTVAGFDCVGADDVAVSLHEMDDKVEEL
QGRPGSNKDTAIRAYDDAHVVPYSVSLSMPASPSGFHLSQFMPVAPTDHVHRPEPTARSP
RLVKQTRFHSQPIVLNMNLHPSSSTNKNVDEARRWDSARDKRFDPFKTFSGRLERQLSNL
RGRPQDPVDGVSSSPDSEEETDQVPAADRYFDALEGPELDTLRATEVPVLPKDEKWPFLL
RFPISAFGMCLGVSSQAILWKTLASAPATAFLRVSPAVSHALWYVALALTALVSSTYLLK
VVFYLEAVRREFYHPVRANFFFAPWIACLFLALGAPRLVVAEMHRGVWYALMAPILCLEL
KIYGQWMSGGQRRLSKVANPSNHLSVVGNFVGALLGARMGLREGPVFFFAVGLAHYLVLF
VTLYQRLPTNVTLPKELHPVFFLFVAAPSVASMAWAKINGQFDNGARIAYFIALFLYMSL
AVRINFFRGFRFSLAWWAYTFPMTGASVATITYATEVTNVLTRALSIGLSGISTVTAAGL
LVTTVFHAFVLRDLFPNDVSIAITRKKPKFSKILAQVRSSSSDMKELVLSLSNKPAAQSD
CGDTETDPSVTAKSRAEP*

Other information
Ka divergence:0.182517KaKs divergence:0.0824742
GC content 1 (%):66GC content 2 (%):66GC content divergence:0
Length 1 (bp):2004Length 2 (bp):2037Length divergence:0.008
MFE 1 (kcal):-953.32MFE 2 (kcal):-956.4MFE divergence0.002