Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G011479-GRMZM2G068271
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278407
Function (paralog2):hypothetical protein LOC100275452

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.81974725320463
Log2 mRNA fold difference:0.50962027878884
Log2 TE fold difference:-1.2838820306056
Sequences
Protein sequence

MRQLHLSPQLSPSPVLSSHFSPPPAEALSWRRRLHRGRAFQPPLSSLRDPNKATLRKASS
NVPFRLGGGGSGSPKDRRPADDDKEEEEAEGEGGAGALTGTLVAGALLVGFVGGFGAAGY
VYKDQINTFLTQFSGFIDGYGPAGYALFVLVYAGLEVLAIPAIPLTMSAGLLFGSVTGTI
IVSISGTLAAAVAFLIARYFARERILKLVEGNKKFLAIDKAIGENGFKVVTLLRLSPLLP
FSLGNYLYGLTSVKFLPYVLGSWLGMLPGSWAYVSAGAFGRAIIQEESEIGWGGNGQLWT
LSVGLLFTAMAAAYVTRLAKDAVKEIDD*

MGQPHLLPQLSPSPVLYSLFSPPETGATPWRRPLNRGRAFQPPLSSLRETNKATLRKATP
NAPFRLGGGGGGSPKDRRPAADDKEDEDEGRGGAGALTGTLIAGALLVGFVGGFGAAGYV
YKDQINTFLTQFSGFLDGYGPAGYALFVLVYAGLEVLAIPAIPLTMSAGLLFGNVTGTII
VSVGGTLAAAVAFLIARYFARERILKLVEGNKKFLAIDKAIGENGFKVVTLLRLSPLLPF
SLGNYLYGLTSVKFLPYVLGSWLGMLPGSWAYVSAGAFGRALIQDESEIGLGGNEQLWTL
GVGLLFTAIAAAYVTRLAKDAVKEIDD*

Other information
Ka divergence:0.216964KaKs divergence:0.117388
GC content 1 (%):55GC content 2 (%):56GC content divergence:0.009
Length 1 (bp):987Length 2 (bp):984Length divergence:-0.002
MFE 1 (kcal):-394.21MFE 2 (kcal):-389.83MFE divergence-0.006