Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G011588-GRMZM2G148098
Species:maize
Duplication type:WGD
Function (paralog1):BEL1-related homeotic protein 30
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.99723091077965
Log2 mRNA fold difference:-1.4889770817523
Log2 TE fold difference:0.49081314125345
Sequences
Protein sequence

MATYYSSPGSERDSQTMYSAESGNVSYPVPSALGNFLYTNNASSGPYTEFSGIVQPQQNF
MELTGHPSAMSHDSSSNEATNMGSSLTEQRSFGPLKDMRNEMLMHLMDGAHSSGSDLIHN
DAHSTVQLEFGMLNNHNSTSVPLAPGQGLSLSLNTHILAPSYPHWSAKQDLLTPNSYQGD
DNRMKNMQSEASQAIRNSKYLKAAQELLDEIVSVWKCVKQKTDKGPAEAGKADGKETDGG
IKSEGVSSNPQESGANAAAELSTAEKQELQNKMAKLMTMLDEVDRKYKHYYHQMQLVMSS
FNMVAGAGAAKPYTAVALQTISRHFRCLKDAINDQISVIRKKLGEDDNTSGKEGKLTRLR
YIDQQIRQQRAFQQYGMLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLSR
QTGLTRSQISNWFINARVRLWKPMIEDMYKEEIGEAELDSNSSSDNGQRNKDKAPSPEEN
EDLQTPTSQACQTSQLGQSKAIVGGVMGFSGVLAGGFHTEANPDDSFMSLMLKAQRPGET
EGTGLLHDAVAHHSDDGARFMAYHLAEFGRYGNSSNVSLTLGLQHAENSLAVPPNTQPGF
PGVRDQDMYNATAPPLNVASTSSEYDSASQIDQQQQRQRFEPSPLMHDFVA*

MATYYSSPDSERDSQTMYSTESGNASYPVPSALGNFLYLNSASSGPYTEFNGIVQSQQNF
MELTGHPSAISHDSSSNEATNIGTSLTEQRSFGPLKDMRNEMLMHLMDGAHSSGSDLIHN
DDHSTAQLEFGMLNNHNSTSLPSASGQGLSLSLNTHILAPSYPYWSAKQDLLTPNSYQGD
DNRMKNMQSEASQAIRNSKYLKAAQELLDEIVSVWKSVKQKTDKGPSEAGKSDGKETDGG
TKSEGVSFDPQESGANTAAELSTAEKQELQNKMVKLMAMLDEVDRKYKHYYHRMQLVMSS
FDMVAGSGAAKPYTAVALQTISRHFRCLKDAINDQISVIRKKLGEDDDASGKEGKLIRLR
YIDQQIRQQRAFQQYGMLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLSR
QTGLTRSQISNWFINARVRLWKPMIEDMYKEEIGEAELDSNSSSDNVQPNKDKPPSSEEK
DHKTSTSQVCQTSQLGESKANIGGVVSFCGAPAGGFHNDANPDDSFMSLMLKAQRPGETD
GSGLLHDAVAHHSDESARFMAYHLTEFGRYGNNNVSLTLGLQHAENTQPGFPGVRDQDIY
NSTAPLNVTSTSSEYDSASQIDQQRQLFEVSPLMHDFVA*

Other information
Ka divergence:0.0617411KaKs divergence:0.15742
GC content 1 (%):49GC content 2 (%):47GC content divergence:-0.021
Length 1 (bp):1956Length 2 (bp):1920Length divergence:-0.009
MFE 1 (kcal):-615.61MFE 2 (kcal):-608.92MFE divergence-0.005