Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G011598-GRMZM2G042494
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-4.4294593089117
Log2 mRNA fold difference:-7.3223208357409
Log2 TE fold difference:0
Sequences
Protein sequence

MVMANPDMLPPGFRFHPTDEELILHYLRNRAANAPCPVAIIADVDIYKFDPWDLPSRAAY
GDKEWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHSSTTAGESVGVKKALVFYEG
RPPKGTKTNWIMHEYRLAADAQAAHAYRPMKFRNASMRLDDWVLCRIYKKASCQVPAMAA
VPQLSDHDQDEHCGFDDNPYAAMLLQGASYSYPAPPHAAAGAQRMPRIPSLTELFNDPSL
AHFFEEGGGMQDMARLSNPQQQQQHAPLLGRAVTSQQLLLNNGHSMPGGGQAQMDPHPPA
AAASTSSAAAGNNKRKRSSTTTDAGALSSSQASEAKKPNGSCFGATFQIGNGLQGSSLGH
HHMPLHSNMGTMN*

MIKANPDSMLPPGFRFHPTDEELIVNYLRNRAANTPCPVAIIADVDIYKLDPWDLPSRAA
YGDKEWYFFSPRDRKYPNGVRPNRAAGSGYWKATGTDKPIHGSATGGSVVGVKKALVFYK
GRPPKGAKTNWIMHEYRLAAADAHAAHSYYRSMKSRNASMRLDDWVLCRIYKKASHVPPM
AVPPLSDHEQDEPCGFDENPYGATTSAAVLLQGASCPALQAAAGVQRMPRIPSLTELFSD
P*

Other information
Ka divergence:0.228091KaKs divergence:-0.120033
GC content 1 (%):67GC content 2 (%):67GC content divergence:0
Length 1 (bp):1122Length 2 (bp):726Length divergence:-0.214
MFE 1 (kcal):-496.3MFE 2 (kcal):-317.2MFE divergence-0.22