Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G011731-GRMZM2G068361
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275396
Function (paralog2):hypothetical protein LOC100280094

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.41399736967598
Log2 mRNA fold difference:0.25299565299362
Log2 TE fold difference:0.10193878735075
Sequences
Protein sequence

MDDDWELLLASPKAASAAEPYAGGGEDDAGAIKHDYFDLGSDAKYPRRASLSTGDEEEGA
EEGLLRASDNASWVEPDPDDLLFPGRDRAALWSDSSSDGERPEVEATDPVGRAREEGGVM
AAAADGVEGAVAKGGEHVRWWKLPLDALRVWAMRAARSACSVPFAVALLGFAVLGRRLYR
MRRQSKAAARVRLVFDEKKASQFNGQSSRLNESTTMMRRTPFIKPMLPANGVTPWPVLGH
L*

MTRAQTKKGIEFLPPSSPHTLNSKQSSKQARNNHRFLAARESAAPVPRPDTAHHSLQSAF
IQRFPSYLPSESRPRTLAGLREMDEDWELLLASPKAAPAEPYAGGGGDGEVDAGAIKHDY
FDLGSDAKYPRRASPSKGSEEECAEEGPFAASDNAGWVEPDPDDLLFPGRDRAALWSHSS
SDGERPEVEVEVEAADQVERAGVTAAADAGEGAVAKGGGPAQWWRLPLDVLRVWALRAAR
SVWSVPLAVALLGFAVLGRRLYRMRRQSKAVARVRLVLDEKVTPSHHLPCTRLAPHLWIS
PSSRACWFFHSRL*

Other information
Ka divergence:0.421178KaKs divergence:-0.337036
GC content 1 (%):68GC content 2 (%):68GC content divergence:0
Length 1 (bp):726Length 2 (bp):942Length divergence:0.129
MFE 1 (kcal):-370.86MFE 2 (kcal):-459.5MFE divergence0.107