Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G011888-GRMZM2G012143
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277365
Function (paralog2):hypothetical protein LOC100384615

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.42464696695112
Log2 mRNA fold difference:-1.4890813677351
Log2 TE fold difference:1.0741122456798
Sequences
Protein sequence

MGSLPAPASAEFAPRPRGRATVVASDLAPLFSAQRRHLDHFFDRLDMAQAAAFAQALLDA
PGAVFFTGVGKSGIVARKTAQTLASLGLARAGFLAPVDALHGDIGALFPGDVLVILSKSG
ASDELLALAPCARAKGAYLVSLTSAASGDDCPLAAACDLNVHLPLQGEVCPFGLAPVTST
AIQMVFGDTVIAAIMEARRLSRDQYASNHPAGKIGKTLIFKVKDVMKKQNELPLCKEGDM
IMDQLTELTSKGCGCLLVVDEEHHLIGTFTDGDLRRTLKASGPAIFSLTVGEMCNRNPRT
ITAEAMAVEAMEKMEAPPSPVQFLPVVNENNVVCGIITLHGLVSAGL*

MPACSQTARNQIRPPPDISPRRGISSNAPLTAPMGSLPVPASTECTPQGRATVSASDLAP
LFSAQRRHLDHFFDRLDMSQAAAFAQVLLDAPGAVFFTGVGKSGIVARKTAQTLASLGFA
RAGFLAPVDALHGDIGALFPGDVLVLLSKSGASDELLALVPCARAKGGYLVSVTSAASGA
DCPLAAACDLNVHLPLQGEVCPFGLAPVTSTAIQMVFGDTVIAAIMEARRLSRDQYASNH
PAGKIGKTLIFKVKDVMKKQNELPLCKEGDMIMDQLTELTSKGCGCLLVVDEEHHLIGTF
TDGDLRRTLKASGPAIFSLTVGEMCNRNPRTITADAMAVEAMEKMESPPSPVQFLPVVND
NNVVCGIITLHGLVSAGL*

Other information
Ka divergence:-0.113383KaKs divergence:-0.342857
GC content 1 (%):64GC content 2 (%):63GC content divergence:-0.008
Length 1 (bp):1044Length 2 (bp):1137Length divergence:0.043
MFE 1 (kcal):-469.46MFE 2 (kcal):-489.14MFE divergence0.021