Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G011923-GRMZM2G033117
Species:maize
Duplication type:WGD
Function (paralog1):gda-1
Function (paralog2):gda-1 (LOC100282537), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.89704988045623
Log2 mRNA fold difference:-1.1769535314841
Log2 TE fold difference:0.27371773888263
Sequences
Protein sequence

MDGLWHLGDELRGQPKVVEDRQWSLMTSKLAEITRSRGERTNDLDYARMNAAPDAKQWGK
AASYQHHDEGRMDHHVGLSLKMNDLKMNEAAAAAVMKLPFRGVPYNVNPMYPKGSNANAN
VNAFKMNVGVNKYSSSTNGKDSGGKSGGGSNNNSGGGGNGNGTANGSSAVDKRFKTLPTS
EMLPKNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLYNYTTHQLH
GVFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDSFRPVLHHYDGPK
FRLELSIAETLSLLDLCEKEGI*

MDTWTTCLLSFLPSIPPCLRPLLTPVGRGAAADCWDCPTPSAQVIFGPFAGDEHHQVCQV
DRAMDSLWHLGDELRGQPKVVEDRQWSLMTSKLAEITRSKGERMNTVPDAKQWDKTSYQL
HDDSRIGHIGLMNLDLKMNEAAAMKLPFRGMPYNMNQMYLKGSNANSNVNAFKMNVGVNK
YSNSPNGKDANGKNNGGSGGNNNNGSANGTSVADKRFKTLPTSEMLPRNEVLGGYIFVCN
NDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLYNYTTHQLHGVFEAASFGGSNIDPTA
WEDKKCKGESRFPAQVRICIRKLCKPLEEDSFRPVLHHYDGPKFRLELSIAETLSLLDLC
GKEGI*

Other information
Ka divergence:-0.3437KaKs divergence:-0.0285111
GC content 1 (%):58GC content 2 (%):54GC content divergence:-0.036
Length 1 (bp):969Length 2 (bp):1098Length divergence:0.062
MFE 1 (kcal):-383.9MFE 2 (kcal):-426.8MFE divergence0.053