Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G012052-GRMZM2G007276
Species:maize
Duplication type:WGD
Function (paralog1):ubiquitin-conjugating enzyme protein E2
Function (paralog2):hypothetical protein LOC100272466 (LOC100272466), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASSASQASLLLQKQLKDLAKNPVDGFSAGLVDDSNIFEWQVTIIGPPDTLYDGGYFNAI
MTFPQNYPNSPPSVRFTSEMWHPNVYPDGRVCISILHPPGEDPNGYELASERWTPVHTVE
SIVLSIISMLSSPNDESPANIEAAKDWREKRDEFKKKVRQCVRKSQEML*

MAGTPSQASLLLQKQLKDLAKNPVDGFSAGLVDDSNVFEWQVTIIGPPDTLYDGGYFNAI
MTFPQNYPNSPPSVRFTSGMWHPNVYPDGRVCISILHPPGEDPSGYELASERWTPVHTVE
SIVLSIISMLSSPNDESPANIEAAKDWREKRDEFKKKVRQCVRRSQEML*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):510Length 2 (bp):510Length divergence:0
MFE 1 (kcal):-160.6MFE 2 (kcal):-176.8MFE divergence0.048