Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G012088-GRMZM2G150901
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192981
Function (paralog2):hypothetical protein LOC100277366

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.40927436757247
Log2 mRNA fold difference:1.1417296380631
Log2 TE fold difference:-0.72187653711519
Sequences
Protein sequence

MARPRKAKPPPPPPRAAAPSIAEALLMATICMVGLPVEVRVRDGSTYSGVLHTACVDAGY
GVVLKKAKKIANGKGDANLSLGSFVDTLVVHPDDLVQVIAKGLSLPVKGVCKPLDSNVVA
SNGSLKRQNSHANDPKMSKPENISPLMQTEKCTSVGQGKNTSVKKNGQNSGSATSLSSST
GLMGPCFSMNGVSGSATMVPKVDAATSSAIAAPLVASDVKPSQPVSNSATKMIMSSKSTA
KEFKLNPCARVFSPSFASSRQVLAAMAPVDTYYISHSAPEVPMGVPVYESKSVPGVSPLT
NKVHCSNLSPANYAISPQYVQSIVGHNTSRLDPARVGTPYHPMQVGATYTTPSPQPAMTG
KFSPVVYVHPVPQDPLHGTPSGFQGWPRPVLLNSYQASMQKFQGNTPVYLAPPIMATGNL
PLVVPSPAPLVQPFQAIHPIMVPAASSVVPGKYM*

MARPRKPPPPSPPKAAAPSIADALLLATVCMVGLPVEVRVRDGSAYAGVLHTACVDAGYG
VVLKKAKKIANGKGDVNLSLGSFVDTLVVCPDDLVQVIAKGLSLPLKGVCKPLDSNVVAA
SGSLKPQISHANDPKMSNKTKNMSPLMQAEKCTSVGQEKNTSVKRNGQDNGITTSLSSST
RHVGACLSNNWDSRSGSMVPKVDVITSSASAVPVVASGVKPSQPVNNSVAKIVTSSKTAA
KEFKLNPSAKVFSPSFASSRQVLAAAAPVDTYYISHSAPEVPMGVPVYEPKSVSGVSPLS
NKVYCSNLSPANYAISPQYVPSIMGHNASRLDPSRIGTPYHPMQVGATYTTPSPQPVMAG
KFSPVVYVQPGPQDAMHGTTVGFQGWPCPLLLNSYQASMQKFQGNPPVYLAPPVMATGNL
PLVVPSPASLVQPFEAIHPIMVPAASSMVPGKYM*

Other information
Ka divergence:0.138111KaKs divergence:-0.194551
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):1365Length 2 (bp):1365Length divergence:0
MFE 1 (kcal):-450.86MFE 2 (kcal):-447.09MFE divergence-0.004