Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G012119-GRMZM2G086763
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272863
Function (paralog2):chloroplast post-illumination chlorophyll fluorescence increase protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.82217251992805
Log2 mRNA fold difference:-1.2105028789382
Log2 TE fold difference:0.38784470713139
Sequences
Protein sequence

MATLSSCSRLSSGTGAAAIHRQPARAGAVLVVTCRRSSSATVRAAAAATAAAPAAVELQN
KGVSLPTWAEFELGRAPVYWKTSSGLPPSPGEGLTLFYNPAATKMAPNEVFGVAFNGGFN
QPIMCGGEPRQMTLQERGKADPPIYTIRIRVPQHAVSLIFSFTNGAEWDGPYTLKFRVPK
PWQNKPLSFFNEGLADELNREGACDLAIYPDENIAITSCAMDGYLEEGGDRCKLDIVSGC
TDPSSDMFDPLATVDDGSCPLESDSEE*

MATLSSCSRLSSGTGAAAIRRQPKPTRAGVLFTSRRGSSASVRTAAAAATAAPAAVEQQN
TGVSVSLPTWAEFELGRAPVYWKTSNGLPSSPGEGLTLFYNPAASKMAPNDVFGVAFNGG
FNQPIMCGGEPRQMTLQVRGKADPPIYTIRIRVPQHATSLIFSFTNGAEWDGPYTLKFRV
PKPWQKKPLSFFNEGLADELNREGACDLAIYPDENIAITSCAMDGYLDEGGDRCKLDIVS
GCTDPSSDMFDPLATVDDGSCPLESDSEE*

Other information
Ka divergence:0.310064KaKs divergence:0.363452
GC content 1 (%):68GC content 2 (%):68GC content divergence:0
Length 1 (bp):804Length 2 (bp):810Length divergence:0.004
MFE 1 (kcal):-377.2MFE 2 (kcal):-383.1MFE divergence0.008