Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G012628-GRMZM2G058098
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382170
Function (paralog2):hypothetical protein LOC100193230

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.5104424351798
Log2 mRNA fold difference:-0.80759098830142
Log2 TE fold difference:-0.71347129068982
Sequences
Protein sequence

MMQQPPPQQPQPGMAPPPPPQAAGGQPPQWGGIPPPMAQQYGAPPPQQPPAMWGQPPPQA
HYGQAPTPQQYYAAPPVPVQAPAAPAAADEVRTLWIGDLQYWMDENYVFGCFSNTGEVQN
VKLIRDKNSGQLQGYGFVEFTSRAAAERVLQTYNGQMMPNVDLTFRLNWASAGEKRDDTP
EYTIFVGDLAADVTDYLLQETFRVHYPSVKGAKVVTDKLTMRTKGYGFVKFGDPTEQARA
MTEMNGMPCSSRPMRIGPAASRKNTGGVVQERVPNSQGAQSENDPNNTTIFVGGLDPNVT
EDTLKQVFSPYGEVVHVKIPVGKRCGFVQFVTRPSAEQALLMLQGALIGAQNVRLSWGRS
LSNKQAQPQQESNQWGAAAGAGGYYGGYGQGYEAYGSGYAQPQDPNMYGYGAYGGYPNYQ
QQPAAQQQQQQQ*

MMQQPPQPQPGMALPPPPQTGGGQPPQWGAIPPPMTQQYGAPPPQQPPAMWGQPPSQAHY
GQAPPPQPYYAAPPVPAAPAAADEVRTLWIGDLQYWMDDNYVFGCFSNTGEVQNVKLIRD
KNSGQLQGYGFVEFTSRAAAERVLQTYNGQMMPNVDLTFRLNWASAGEKRDDTPDYTIFV
GDLAADVTDYLLQETFRVHYPSVKGAKVVTDKLTMRTKGYGFVKFGDPTEQARAMTEMNG
MPCSSRPMRIGPAASRKNAGGVVQERVPNSQGAQSENDPNNTTIFVGGLDPNVTEDVLKQ
AFSPYGEVIHVKIPVGKRCGFVQFVTRPSAEQALLMLQGALIGAQNVRLSWGRSLSNKQT
QPQQESMQWGAGAPAGVGDYYGGYGQGYEAYGSGYAQPQDPNMYGYGAYVGYPNYQQQPA
AQQPQQQQVKLLAN*

Other information
Ka divergence:0.345116KaKs divergence:0.100892
GC content 1 (%):53GC content 2 (%):52GC content divergence:-0.01
Length 1 (bp):1299Length 2 (bp):1305Length divergence:0.002
MFE 1 (kcal):-482.8MFE 2 (kcal):-467.1MFE divergence-0.017