Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G012861-GRMZM2G127687
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100382649

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.2136300911867
Log2 mRNA fold difference:3.0395542548958
Log2 TE fold difference:0
Sequences
Protein sequence

MPLPPLLLCVCLYLTHLPRLASSEPDADKAALLAFLAGVGRGATARARINWPTTPLACAS
PGHGPGWTGVTCSPDGARVVALHLPGLGLSGAVQSGTPFLVQQRSFRCSTSTHQIHPRER
PRQAAMPLPLPLPPLLLCVCVCVCLCLYLTHLPRLASSEPDADKAALLAFLAGVGRGATA
RARINWPTTPLACAGPGPGWTGVTCSPDGARVVALHLPGLGLSGAVQPGTLGRLTALQLL
SLRSNNLSGPLPADLLRLPALAGLHLHRNAFSGALPPGLAGLAALQALDLSSNGFGGGIP
GALTSLTRLVALDLSNNSLSGRVPDLGLPALQFLNLSNNRLDGPVPPSLLRFADAAFAGN
DLTRPPAAAPPAAAAPAARTRRVRLSEAAILAVAVGGCVLAFAVAAVLLLAFCNREGRDD
DDDDTGGAGGKGGEKKGRESPESKAVIGKAGEGNRMVFFEGPALAFDLEDLLRASAEVLG
KGAFGTAYRAVLEDATTVVVKRLSKEVSAGRRDFEQQMELVGRIRHRNVVELRAYYYSKD
EKLLVYDYYASGSVSNMLHGKRGEERTPLDWETRWKIALGAARGVAHVHAENNGRFVHGN
IKASNVFVNRDGYGCISDLGLAQLANPIAARSRSLGYCAPEVADTRKASQASDVYSLGVL
VLELLTGRSPVQVSGGRGSEVVHLVRWVQSVVREEWTAEVFDGALLRVPDIEEEMVEMLQ
IAMACVSRTPDRRPKVADVVRTVEEVRRSGTGTRPPSPPATAADADQSEMESSSSAAAAA
AQ*

MPTPPLRGAGLLLRICLFLCLSLRPRLASSEPDADKAALLAFLSGVGRGATARARINWST
THLACSADGPGPGWTGVTCSADGARVVALHLPGLGLSGAVPPGTLGRLTALQLLSLRSND
LSGPLPADLLRLPALEGLHLHRNAFSGALPAALAGLTALQVLDLSFNAFDGAVPGALANL
TRLVALDLSNNSLSGRVPDLGLPALRFLNLSNNRLDGTVPASLLRFPDAAFAGNSLTRPA
PAQAPPVVVAPPPGLAAPPPARRRPRLSEAAILAIAVGGCVLGFAVAALLLLAFCNSSRE
GRDEETVGGGAAAGKGGEKKGRESPESKAVIGKAGDGNRMVFFEAPSLAFDLEDLLRASA
EVLGKGAFGTAYRAVLEDATTVVVKRLKEVNAGRRDFEQQMELLGRIRHDNVVELRAYYY
SKDEKLLVYDYYSRGSVSNMLHGKRGEDRTPLDWETRLKIALGAARGVAHIHTENNGRFV
HGNIKASNVFINKHERGCVSDHGLASLMNPVTVRSRSLGYCAPEVADTRKASQSSDVYSF
GVFVLELLTGKSPVQITGGNGGDVVHLVRWVQSVVREEWTAEVFDGELLRYPNIEEEMVE
MLQVAMACVSRSPERRPRMADVVRTIEEVRRSGSGTATGTGTRPSTEASTPATAAEAAQS
RAEEGGSSAVAQ*

Other information
Ka divergence:-0.152205KaKs divergence:-0.820377
GC content 1 (%):72GC content 2 (%):71GC content divergence:-0.007
Length 1 (bp):2349Length 2 (bp):2019Length divergence:-0.076
MFE 1 (kcal):-1241.35MFE 2 (kcal):-1038.72MFE divergence-0.089