Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G012891-GRMZM2G090865
Species:maize
Duplication type:WGD
Function (paralog1):MTD1
Function (paralog2):hypothetical protein LOC100276653

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSTAVAEVRPPYGFPGSGKGSGGGYGKEAHLAAAGKRRSDGFFIEEEEVEEDVLTDNSSI
GAPSPSGSSIGENSSSEAGGDDGEEEVESKLKEGDVLGCLDALEDSLPIKKGLSSFYSGK
SKSFTSLAEATAAAAAVKEVLAKPEKPFNKRRRILANWSRRASCSSLATATYLPQLLGPD
HAVAEGDEGEEDDSDDDVEYSQVPHHGKNVRDAPTSPLPLPRLGGVGSMQRRNGLGSFRS
PRSFSLSDLRNSSADGSD*

MSTAVAEARPRYGFPGSGKGGSGGGGGGHGKEADMAAVGKRRSDGFFIEEVAEEEVLTDT
SSVGAPSPSGSSIGENSSSEAGGDDVDEEVESKLKEDDALDCLDALEDSLPVKASRASTP
ASPGRSPASPRPRRRWRRPRSWRSRRTRSTSGAASWPTGPGEPPAARWPRPPTCPRSWAP
TTPSPRGTRARRTTPTPTTWSAASCRRRTAERTSGTRGHCHPLDSAVLGCGGGTGRMAAS
GASDPRGPSRCPISTAALRGSSD*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):65GC content 2 (%):69GC content divergence:0.03
Length 1 (bp):777Length 2 (bp):792Length divergence:0.01
MFE 1 (kcal):-371.5MFE 2 (kcal):-418.71MFE divergence0.06