Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G012964-GRMZM2G042623
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384506
Function (paralog2):hypothetical protein LOC100279770

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.5128778158946
Log2 mRNA fold difference:-1.4638329234436
Log2 TE fold difference:-0.049504589322593
Sequences
Protein sequence

MVTEMAARGGEAAAFGAEADRGDFEVFRSGSAPPTVEGALGAAAAAADLLVDDDLRADPA
YQSYYYSNAHLNPRLPPPLLSKEDWRSSHHRLRSAAFGGIGDGRRQQQPAAQGTVGLPGI
DLARQRSFSTVFQEDSYQRDMDRQTASHNSSESLCSSGIQYGLNRGPGTIGGLHSSNSLR
SLDEIPNNDLPSNTFASLLGSSLSRSASPDPELVRRAPSPSLPPIGVKVGNTDKMNGGSS
SFRRSSSAIGGSDDLVAALSGMNLSSRAMSGQTMDQSQLYQDVDNVQKFLFDRQGDQPNG
NQQHYMRRPEHGQSKLSDGYSANLANSSTMRNQINSGSFTSFDSLSLGSGFPSPRIGSRS
PGGTVSSRQNLAGMSNMLNYNGIGSPTASPSLQTSIDPAYIQYLAQIAATWDDPLMDRSH
LGSSYMDLLGTQKANLGPLLQSQKQYGYCGNLGFNLGGYAGSPLTSPVLPSSPIAPGSPL
RHGDRNMRFPPGMRNFGNSFGSWNSGMSGKMDANLMPSLLEEFKSNKSKSYELSEIAGHV
VEFSADQYGSRFIQQKLETASTEEKDMVFSEIMPQALTLMTDVFGNYVVQKFFEHGSTAQ
IKELAGQLIGRVLALSLQMYGCRVIQKAIEVVDLDLQTKMVAELEGHVMRCVRDQNGNHV
IQKCIECIPQHAIEFIVSTFYGQVVMLSTHPYGCRVIQRVLEHCDDPKTQQIMMDEILQS
VCLLAQDQYGNYVVQYCCLFHVAMCCAAVWNRKQQERCEYCCLSHVAMCCAAVWNRKQQE
RCEHVLEHGKPHERSAIIEKLIGQVVQMSQQKFASNVIEKCLAFGNPVERQVLIGEMLGS
TSESEPLEVMMKDQFANYVVQKVLETCDDQQREMILTRIKTHLNTLKKYTYGKHIVARVE
KLVAAGEKRLGLQPACTAA*

MVTEMAARGGEAAAFGAETDRGDFEVFRSGSAPPTVEGALGAAGADGGLLVDDDLRADPA
YQSYYYSSAHLNPRLPPPLLSKEDWRSSHHRLRSAGFGGIGDGRRQQQQASAAEGTVGLP
GIDLGRQRSFSTIFQEDSYQRDMDRHTASHNSNDLLGSSGIQYGLNRGSGTIGGLHSSNS
LRSLDEIQNNDLPSNTFASILGSSLSRSASPDPELVRRAPSPSLPPIGVKVGNTDKKING
GSTSFRRSSSAIGESDDLVAALSGMNLSSRAMSGQTMDQSQLYQDVDNVQKFLFDRQGDQ
TTGNQQHYMRRPEQGQSKLPDGYSANLANSSTMRNQINAGSFTSFDSLSLGSGFASPRIG
SRSPGGTVSSRQNLAGMSNMLNYNGIGSPTASPSLQTSIDPAYIQYLAQLAATCDDPLMD
RGHLGNSYMDLLGTHKANIGPLLQSQKQYGYYGNLGFNLGYPGSPLASPVLPSSPIAPGS
PLRHGERNMRFPSGMRNFGNSFGSWNSGMGGKMDANLMPSLLEEFKSNKSKSYELSEIAG
HVVEFSADQYGSRFIQQKLETASTEEKDMVFSEIMPQALTLMTDVFGNYVVQKFFEHGST
AQIKELAGQLIGRVLALSLQMYGCRVIQKAIEVVDLELQTKMVAELEGHVMRCVRDQNGN
HVIQKCIECIPQHAIEFIISTFYGQVVMLSTHPYGCRVIQRVLEHCDDPKTQQIMMDEIL
QSVCLLAQDQYGNYVVQHVLEHGKPHERSAIIEKLIGQIVQMSQQKFASNVIEKCLVFGN
PVERQVLIGEMLGSTSESEPLEVMMKDQFGNYVVQKVLETCDDQQREMILTRIKTHLNTL
KKYTYGKHIVARVEKLVAAGEKRLGLQPACTAA*

Other information
Ka divergence:-0.220352KaKs divergence:-0.198685
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):2760Length 2 (bp):2622Length divergence:-0.026
MFE 1 (kcal):-998.44MFE 2 (kcal):-905.84MFE divergence-0.049