Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G013255-GRMZM2G164945
Species:maize
Duplication type:WGD
Function (paralog1):alpha-L-fucosidase 1
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.81424769919712
Log2 mRNA fold difference:-0.21754524610581
Log2 TE fold difference:-0.53195857899568
Sequences
Protein sequence

MASPLLCLAAAALAVAVLVSATEAWRATPPPLPVLPIPSAPQLRWQRREVIMFFHFGMNT
FTDSEWGTGSEDPSLFRPAGLNATQWMDAARAAGASLVILVAKHHDGFCLWPSDYTAHSV
RASPWRGGRGDVVREFVGAARARGLDAGLYLSPWDRHDQRYGEEVAYNEYYEAQLHELLT
GYGSVSEIWFDGAKGKNATNMTYHFQEWFQTVKQLQRSINIFSDDGPDVRWVGDEKGYAG
TTCWSTVNRSMITIGEAGIEKYLNAGDPRGRDWVPPECDVSIRPGWFWHKNETAKPLSQL
LEIYYNSVGRNCVLLLNAPPNSTGLVEDADIARLREFGAAVATVFGTDLAAGSEARASSE
RGARFAARNVMDGRDDTYWAPTAEDGRRNGYWIELRRRPGARARAFNVVRIQEHVALGQR
VERHAVYVDGAPVANGTTVGHKRLHRLPCPVAGTTVRVWITALRGPPLLSAVGLHYDPFV
ASDTM*

MAKPTRPFPIIAKISSPSAWAAQWPVYIVSSLHMAVPGKEAPTTVDTMASPLLSLATAAL
AVAVLISTTEAWRATPTPLPVLPIPSAAQLKWQRREVIMFFHFGMNTFTDSEWGTGWEDP
SLFYPARLDATQWMDAARAAGASLAILVAKHHDGFCVWPSEYTAHSVRASPWRGGRGDVV
REFVDAARARGVDTGLYLSPWDRHDERYGQEVAYNEYYESQLHELLTGYGSVSEIWFDGA
KGKDATNMTYHFQEWFQTVKQLQPSINIFSAVGPDVRWVGDETGEAGTTCWSTVNRSMIT
IGEASDEKYVQTYNTIS*

Other information
Ka divergence:0.595285KaKs divergence:0.18831
GC content 1 (%):71GC content 2 (%):64GC content divergence:-0.052
Length 1 (bp):1458Length 2 (bp):954Length divergence:-0.209
MFE 1 (kcal):-778.3MFE 2 (kcal):-432.14MFE divergence-0.286