Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G013342-GRMZM2G024150
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191984
Function (paralog2):Photosystem I reaction center subunit II

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0707798257984
Log2 mRNA fold difference:-2.3288172490781
Log2 TE fold difference:1.2580114379299
Sequences
Protein sequence

MAMATQASAATRHLLAAAWAPAAKPRQLSSQLALPSSSSRGPAPLRASTEEAVEAPKGFV
APQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPNLLK
LARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNFRS
IGKNVNPIDVKFTGKATFD*

MLAPPSSIPFHSIPVLAHLAPPSASAHPPRIVMAMATQASAATRHLVAAAASAWAPSAKP
RQLSSQLALPPSSSRAPAPLRATAGEAVTEEAPKGFVAPQLDPSTPSPIFGGSTGGLLRK
AQVEEFYVITWVSPKEQVFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKITYQ
FYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNFRSIGKNVNPIDVKFTGKSTFD*

Other information
Ka divergence:0.503539KaKs divergence:0.405443
GC content 1 (%):69GC content 2 (%):68GC content divergence:-0.007
Length 1 (bp):600Length 2 (bp):711Length divergence:0.085
MFE 1 (kcal):-289.7MFE 2 (kcal):-322.2MFE divergence0.053