Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G013600-GRMZM2G086904
Species:maize
Duplication type:WGD
Function (paralog1):LOC100283558
Function (paralog2):DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide (LOC100282532), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.5161418496853
Log2 mRNA fold difference:2.0036275074337
Log2 TE fold difference:-0.44352578876424
Sequences
Protein sequence

MADDDYNEIDMGYEDEPPEPEIEEGAEEELENNEDAPDDVIGGEGEDKEQEKTKRERKTT
KYMTKYERARILGTRALQISMNAPVMVELEGETDPLEIAMKELRARKIPFTIRRYLPDGS
YEDWGVDELIVEDSWKRQVGGD*

MADDDYNEIDMGYEDEPPEPEIEEGAEEEPENNEDAPDDVIGGEGEDKEQEKTKRERKTT
KYMTKYERARILGTRALQISMNAPVMVELEGETDPLEIAMKELRARKIPFTIRRYLPDGS
YEDWGVDELIVEDSWKRQVGGD*

Other information
Ka divergence:1KaKs divergence:0.99455
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):429Length 2 (bp):429Length divergence:0
MFE 1 (kcal):-118.86MFE 2 (kcal):-120.9MFE divergence0.009