Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G013790-GRMZM2G171807
Species:maize
Duplication type:WGD
Function (paralog1):WAK1 - OsWAK receptor-like cytoplasmic kinase (OsWAK-RLCK)
Function (paralog2):hypothetical protein LOC100381711

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MTQPTLLFLLPLLATSMLLQFHDHASADCEPAAACGDLTLRYPFWLGSSSANDTHHDTPS
PSPPPCAHHHPGFEVWCSDDGRVASLKGTYIHVLSINYSAGSLVASHARIAGAGGVCQAD
FNVSSSIALSVFTFSPRKNRALCFLYACNGTAPPSGPGYANATSSCAAPVYAFLADGDFY
WDRPPAVAAGACKYSYVPVLGSEAAVMTAANYSRLLKDGFVLNWEVAGVADCQDCNASAE
QCRHGNRSAAAGSTCAGPKGRTSKVVGIVCGVVAVSLLAACFFFVWHKRKRRKQARAPNG
FMHSESSLQSYSKDLELGGSPQIFTYEELEEATDGFSDSRELGDGGFGTVYKGKLQDGRV
VAVKRLYKNNYKRVEQFKNEVDILSRLLHQNLVILYGCTSRSSRDLMLVYEFVPNGTVAD
HLHGSRASERDLTWPLRVNIAIETAEALAYLHAVEIIHRDVKTNNILLDNSFHVKVADFG
LSRLCPPEVTHVSTVPQGTPGYVDPVYHQCYKLTEKSDVYSFGVVLVELISSKPAVDMSR
THSDINLANMALNRIQNHEVDRLVDPELGYETDDGTKKSIDLVMELAFQCLQLERDSRPS
MKEVVVALNCIKNGDSPENKMDRSSSSPKEDAHLLTNSIQYSPDSVIHRFHSQSTTHSAA
SNASG*

MQPLLLLLLASSLLRPPAAASAADSSSGCWPKTCGHLNVTYPFWVEEPGRAPCGPPSFQL
KCNGSGAFLSISVYQAYQVLDIFPENSSFHVVDHNLPLATGCPAPTMNISLFSPGTFVFS
GLNRELLFLGKCTGFPPAESAGFRSLPCDNSSFVRLGDGRNFSSQGIQGGVPHGCLFTVV
PVLGAPDGNGDDDDYVASMRNGFLVDWKAVPGDCPKCMARGGECTYGGPDAEFACDCSGG
KCGGNSNKNRILGIVCGVAGGGLLVVSVCFFFVWRKHKRRKQARAPNGCMRSESSMQSYS
KDLELGGSPHIFTYEELEEATDGFNDSRELGDGGFGTVYKGKLRDGRVVAVKRLYKNNYK
RVEQFINEVDILSRLLHQNLVILYGCTSRSSRDLMLVYEFIPNGTVADHVHGSRASERGL
TWPRRMSIAIETAEALAYLHAVEIIHRDVKTNNILLDNSFHVKVADFGLSRLYPPEVTHV
STVPQGTPGYVDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMAL
NRIQNHEVGQLVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEALNRIR
NGDSLENNKTDRSSSSPKEDARLLTSSIQYSPDSVIHRFHSQSTTHSAASNASG*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):57GC content 2 (%):59GC content divergence:0.017
Length 1 (bp):1998Length 2 (bp):1965Length divergence:-0.008
MFE 1 (kcal):-755.89MFE 2 (kcal):-806.94MFE divergence0.033