Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G013821-GRMZM2G156785
Species:maize
Duplication type:WGD
Function (paralog1):HMG-like nucleosome/chromatin assembly factor D
Function (paralog2):high mobility group protein3

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.63582408030491
Log2 mRNA fold difference:0.51886106239286
Log2 TE fold difference:0.085137069741498
Sequences
Protein sequence

MKGKADTSKKDEGRLRAGGAAGKRKKAAASGKPKRPPSAFFVFMSEFRQEYQALHPGNKS
VATVSKAAGEKWRAMSDQEKQPYVDQAGQKKQDYEKTKANFDKKESTSSKKAKTEDEDGS
KSEVDDEDGSSDEENDDDE*

MKGKANASKKDEARLRAGGGGAGKRKKAAASGKPKRPPSAFFVFMSEFRQEYQAQHPGNK
SVAAVSKAAGEKWRSMSEQEKQPYVDQAGQKKQDYEKTKANIEKESTSSKKAKTDDDDGS
KSEVDDEDGGSDEDNDDDE*

Other information
Ka divergence:0.129615KaKs divergence:-0.4002
GC content 1 (%):56GC content 2 (%):58GC content divergence:0.018
Length 1 (bp):420Length 2 (bp):420Length divergence:0
MFE 1 (kcal):-140.5MFE 2 (kcal):-150.1MFE divergence0.033