Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G014240-GRMZM2G148200
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382506
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.3956707054844
Log2 mRNA fold difference:-1.512663843479
Log2 TE fold difference:0.060103865024763
Sequences
Protein sequence

MAILSALATEVLIPVAAVIGIAFAVVQWVVVSRVKLSPAASGGSGGKAGYADSLIEEEEG
LNDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMAIFAVVIFLFLGSVEGFSTKSQPC
TYSKDKYCKPALFTALFSTVSFLLGAITSLVSGFLGMKIATYANARTTLEARKGVGKAFI
TAFRSGAVMGFLLASSGLVVLYITINVFKLYYGDDWEGLFESITGYGLGGSSMALFGRVG
GGIYTKAADVGADLVGKVERNIPEDDPRNPAVIADNVGDNVGDIAGMGSDLFGSYAESSC
AALVVASISSFGIDHDFTGMCYPLLVSSVGIIVCLITTLFATDFFEVKAVKEIEPALKKQ
LIISTVLMTFGIALISWLALPAKFTIYNFGTQKEVSNWGLFFCVSIGLWAGLIIGFVTEY
YTSNAYSPVQDVADSCRTGAATNVIFGLALGYKSVIIPIFAIAVSIYVSFSIAAMYGIAV
AALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFA
IGSAALVSLALFGAFVSRAGVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKM
VEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVET
LSGVLAGALVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSDCHKAAVIGDT
IGDPLKDTSGPSLNILIKLMAVESLVFAPFFATQGGLLFKYL*

MAILSALATEVFIPVAAVIGIAFAVVQWVLVSRVKLSPAAAASGGSKNGYGDYLIEEEEG
LNDHNVVVKCAEIQTAISEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPC
TYSKDKYCKPALFTALFSTVSFLLGAITSLVSGFLGMKIATYANARTTLEARKGVGKAFI
TAFRSGAVMGFLLASSGLVVLYITINVFKLYYGDDWEGLFESITGYGLGGSSMALFGRVG
GGIYTKAADVGADLVGKVERNIPEDDPRNPAVIADNVGDNVGDIAGMGSDLFGSYAESSC
AALVVASISSFGINHDFTGMCYPLLVSSVGIIVCLITTLFLLLIFFEVKAVKEIEPALKK
QLIISTVLMTVGIAVISWLALPAKFTIFNFGTQKDVSNWGLFFCVAIGLWAGLIIGFVTE
YYTSNAYSPVQDVADSCRTGAATNVIFGLALGYKSVIIPIFAIAVSIYVSFSIAAMYGIA
VAALGMLSTIATGLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGF
AIGSAALVSLALFGAFVSRAGVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALK
MVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVE
TLSGVLAGALVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSDCHKAAVIGD
TIGDPLKGHLGPVPQHPDQAHGGGVPCVCPLLRHPRWPAVQVPVRATPIITAEIYDRPTV
DISNNSCQIASSCVLCASRLAALLFFWSHCSYFLLGPSP*

Other information
Ka divergence:0.419722KaKs divergence:0.308253
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):2289Length 2 (bp):2460Length divergence:0.036
MFE 1 (kcal):-840.28MFE 2 (kcal):-888.12MFE divergence0.028