Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G014419-GRMZM5G805540
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272557
Function (paralog2):hypothetical protein LOC100191968

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.6069949244994
Log2 mRNA fold difference:-2.1047159821
Log2 TE fold difference:0.61240257762193
Sequences
Protein sequence

MAAGTVTARSNGEGHGHGGAGSWYPQRRPHYGYGGGSASFRGCCCCLFLLLTFLALLALA
IALVVVLVVKPRKPQFDLDQVSVQYLLVASPTSPAGLPPATPGAAYISLNITLLFTAQNP
NKVGIRYGATKFDVMYHGVPLGVAAVPGFEQPAHSTRLLQTRVIVDRFNVLQADAQDLIR
DAAINDRVELRITGDVGAKILVLGFSSPKVQVRIDTPPATGTNNIRSLPPQVFLPYTKNT
LPRAKLT*

MTTGSNGDGGGAGSWYPQRRPHYGYGGGSASFRGCCCCLFLLLTFLALLALAVALVVVLV
VKPRKPQFDLNQVSVQYLLVASPTTSPAGVPPGAAYLSLNITLLFTAENPNKVGIRYGAT
AFDVMYHGVPLGVAAVPGFEQPAHSTRLLQTRVIVDRFNVLQTDAQDLIRDAAINDRVEL
RITGDVGAKILVLGFSSPRVQVSVDCTIAISPRSQSLKYKQCGVDGLSV*

www.000webhost.com

Other information
Ka divergence:-0.784205KaKs divergence:-0.0598067
GC content 1 (%):68GC content 2 (%):69GC content divergence:0.007
Length 1 (bp):744Length 2 (bp):690Length divergence:-0.038
MFE 1 (kcal):-313.2MFE 2 (kcal):-299.35MFE divergence-0.023