Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G014951-GRMZM2G341959
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100383989
Function (paralog2):flavonol 4-sulfotransferase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.787446125263
Log2 mRNA fold difference:1.1349627009655
Log2 TE fold difference:0.63032486621626
Sequences
Protein sequence

MAQVPSESSKSDAETSPPADKAPPEISSPECYSDLVSTRPARGGWVQPLVLYQNYWLTPG
RLQHIIPVKELYKPRADDIVLVTYPKCGTTWLKALAFAITTRSRHAFAAHPLLARHPQEL
VPHLELPALAGDLADVEKLAALPEASRDSPTPFPAPAGRVRLPRRVPVPASQGRLRLVVV
LRERHAAQRLLLLLRGPRRRVEHVLRGVLAVGPLLGALPRVLEGELGEASAYPVLEVRRD
RGRPGEGCQDACRLLL*

MAQAASGSSKIDTKAPTSADEAAQPKSYGDLVSTLPARGGWVSLVQYQNYWLNPGRLQNI
IPVKELYKPRADDIVLATYLKCGTTWLKALAFAITTRGRHHQAFAAADHPLLTVHPQEAV
PHLEVHTPGQGLADIERLPSPRLLGTHLPLSLLPPAVATSGCRVVYLCRQPKDVFVSLWH
FVKGMRGGRSPVELDAALAMFCEGVSPFGPVWEHYLEYWKESLARPERVLFLRYEEMVAD
PVRAVRTLAGFFAVPFTDEEEGRGVPEEIVRLCSFEMLSGLESNRTGDLDCGDNTVIGKS
TFFRKGKVGDWENHLTKEMGKKVDAVFEDKLQGSGLVF*

Other information
Ka divergence:-0.669662KaKs divergence:0.999966
GC content 1 (%):62GC content 2 (%):64GC content divergence:0.016
Length 1 (bp):771Length 2 (bp):1017Length divergence:0.138
MFE 1 (kcal):-303.66MFE 2 (kcal):-458.4MFE divergence0.203