Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G015073-GRMZM2G181002
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381461 (LOC100381461), mRNA
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.89382681079058
Log2 mRNA fold difference:-0.023286295998315
Log2 TE fold difference:-0.8740375197057
Sequences
Protein sequence

MSENIDLVLEFLRKNRFAKAEAALRGELTGRADSNDMATQRRVAELKEGEEQQEGLVGSN
VGPKGAAAARSADSSREFIVKEIDVGALPNGSDGKKGSGIGQPQDNVGDLYPWTFSIANS
TAEQLAELLVSEEVPRHRRGAVLAEKRDRGVGTEQPGPVLEQKVSFGRGKGKVDAAGRTE
NSEQCHFRDKSLVPEKEEMLNGCTVKTVLPFPTENPSSSYNSTHHENERKEVKRSSNADG
VGKGAKGHLDEGNRQYYFEKSLDTDLVSDRCFDLQLVGDSQREELPKLPPVRLKSEDKLV
NMNWEEKINHHGSGAKQSSADHAFMIGSYLDVPIGQEITSSGGRRTIGSSWLSVSQGIAE
DTSDLVSGFATLADDSLEYPIGEYWDSDEYDDDDDVGYTRQPIEDETWFLAHEIDYPSDN
EKATGHTRGNDRHDRPTKDEDDDQSFVEEDSYISGEQYFHGKNIAQIGTSEGPMVHGIPD
NDMIAQYDGQLLDSEELNLMHSEPAWQGFVSQNSELGMLGNGKFLNDSERPHPDDLFVED
DQHGSVRSIGVGISSDAADIGSEVRESLIGGSSEGDIEYFNESSLSVSGKRHPHQDTEKK
RVGAKGVKHDQIIYAADIQKGNLPPGAADVGFSFPPPLHSGKNHESDAKSLWSKKDEMYC
INDPDDCQNGMVSDDMLATWRKKNSESSLRSSRDEMTSDVVRSRNSSASYDETEDTSNAR
HHKLDDAQEEDTGTNLDDEEAAALQEQVRQIKAQEEEFETFNLKIVHRKNRTGFEEDKNF
HVVLNSVIAGRYHVSEYLGSAAFSKAIQAHDLHTGMDVCVKIIKNNKDFFDQSLDEIKLL
KYVNKHDPADKYHLLRLYDYFYYREHLLIVCELLKANLYEFQKFNRESGGEVYFTMPRLQ
SIAIQCLEALQFLHGLGLIHCDLKPENILVKSYSRCEIKVIDLGSSCFETDHLCSYVQSR
SYRAPEVILGLPYDKKIDVWSLGCILAELCTGNVLFQNDSPATLLARVMGIIGSIEQAML
AQGRDTYKYFTKNHMLYERNQESNRLEYLIPKKTSLRHRLPMADQGFIEFVAYLLEVNPK
KRPSASEALKHPWLSFPYEPISS*

MPENIDLVLEFLRKNRFAKAEAALRGELTGCADSNGMTVQRCVAELKEDDEQEDLVSSNG
GPNGAVTERSADSSREFIVKEVDVGALPNGLDGKKGSGIGQPQENNVGDLYPWTFSIANS
TAEQLAELLVSEEVPRHRRAAMLAEKRDRGVGTEQPGPLLEQKVSSGRGKGKVDAAGRTA
INEQGHSRDKNLVPEKEEMLNGCTVKTVLPFPGENPSSSYNSTHHENERKEVRRSINADG
VGKGAKGHFDEGNRQNYFEKSLDTDQVSDRCFDLQLVGDNQREELPKLPPVRLKSEDKLV
NMNWEDKINHHGSGAKQSSADHAFMIGSYLDVPIGQDITSSGGRRTIGSSWLSVSQGITE
DTSGFARLDDDSLEYPIGEYWDSDEYDDDDDVGYTRQPIEDETWFLAHEIDYPSDNEKAT
DHTRGPDRHDRPTKDEDDDQSFVEEDSYISGEQYFHGKNIAQIGTSEGPMVNGIPDNDMI
AQYDGQLLDPEELNLMHSEPAWQGFVLQNSELGMLGNGKFLNDSERPHPDDPFVEDDQHG
SVRSIGVGISSDAADIGSEVRESLIGGSSEGDIEYFNESSLSVSGKRHSQQDPEKKRVGA
KGVKHDQINYAAGIQKGNLLPGAADGGFSFPPPLHSVKNHDSDTKTLWSKKDEMYCINDL
DDCQNGVASDDMLATWKKKNSESSLRSSRDEMTSDVVRSRNSSPSYGETEDTTNVRRHKL
DDAQEDTGTNLDDEEAAALQEQVRQIKVQEEEFETFNLKIVHRKNRTGFEEDKNFHVVLN
SVIAGRYHVSEYLGSAAFSKAIQAHDLHTGMDVCVKIIKNNKDFFDQSLDEIKLLKYVNK
HDPGDKYHLLRLYDYFYYREHLLIVCELLKANLYEFQKFNRESGGEVYFTMPRLQSIAIQ
CLEALQFLHGLGLIHCDLKPENILVKSYSRCEIKVIDLGSSCFETDHLCSYVQSRSYRAP
EVILGLPYDKKIDIWSLGCILAELCTGNVLFQNDSPATLLARVMGIIGAIEQAMLAQGRD
TFKYFTKNHMLYERNQESNRLEYLIPKKTSLRYRLPMADQGFIEFVACLLEVNPKKRPSA
SEALKHPWLSFPYEPISS*

Other information
Ka divergence:0.289673KaKs divergence:0.383427
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):3312Length 2 (bp):3297Length divergence:-0.002
MFE 1 (kcal):-1064.45MFE 2 (kcal):-1046.42MFE divergence-0.009