Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G015097-AC203865.3
Species:maize
Duplication type:WGD
Function (paralog1):tesmin/TSO1-like CXC domain containing protein
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEAEVGPPNPPRPEPAGSEPDDARLSPPPPAPAPPPPPPPPPAAEAAAAPTASAAFSLQA
PAPAPAEANGSSDRKRRRKAEDGDGCKTCSCKKSRCLKLYCVCFASGLHCTESCGCEPCH
NKPQLQGTLRMATVLPLKPVQTFEAGQDIVEQVIRSPMDLIRRKCTCKKSGCLKKYCDCY
QGGAGCSINCKCDDCRNPFGRKVGVILDGKSSLTAPILHERNGTEVDSSDEEDDFYMNRQ
LSPIPPSPVSRESSFQQETLVGVEVQTMNGHLYPKPLTQVRPEPSSWQLSRRPIEEPRGE
IWRFSRRPSEDGTSDAMEVHAVAPRESKKAAEVRGDRFGIPRCIEVMSAMAELSPVEKSL
APDVFLDASNREIFLSLSVDIRPIWLRRKMKSLV*

MDADVGAGATNQPWPEPDDAHLSPPPPPPPPPASAPTPAAEAAAPTASAAVSPPAPAEAN
GNSDRKRRRKADDGDGCKACSCKKSRCLKLYCVCYASGSHCTELCGCEPCHNKPPQGAPW
TAPVLPLKPVQTLEAGQEIVEQLIRSPMDLIRRKCTCKKSGCLKKYCDCYQGGAGCSINC
KCDDCRNPFGRKVGVILDGKSSGLPAPVHVHERNGTEADSSGDDEEDDDLYMNRQLSPSP
VSRESSFQQETLVGVEVQTMNGHLYPKPLTQVRPEPSSWQLSAARRPAEEPRGEVWRFSG
RPGEDGASDAVEAARAVAVAPPRESRRPGTRGGDRLRFSIPRCVEAMSAMAELSPVEKSL
APDVFLDESNREIFLSLSVDVRPIWLRRKMKSLV*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):62GC content divergence:0.025
Length 1 (bp):1185Length 2 (bp):1185Length divergence:0
MFE 1 (kcal):-501.24MFE 2 (kcal):-521.88MFE divergence0.02