Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G015132-GRMZM2G161969
Species:maize
Duplication type:WGD
Function (paralog1):dihydrolipoamide S-acetyltransferase
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.3589740677783
Log2 mRNA fold difference:0.88974397615169
Log2 TE fold difference:-1.3950164933723
Sequences
Protein sequence

MSAAQLLRHSRKLRSLQNPVGCENFSFVRHFSSGSGSFIARENGIGKRTRGTRFSQHNQP
AKQLETFSAGVNGSCTWRIASNSLTPSAASWLSGSFSCGQVVSARPFSSSADLPPHQEIG
MPSLSPTMTEGNIAKWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDGAK
EIKVGEVIAITVEEEGDIEKLKDYKPSSSAEPVAPAEPKAEPEPSQPKAEEKKPTQAPEA
KTPKIEEASQSGDRIFASPLARKLAEDNNVPLSSVKGTGPDGRILKADIEDYLASVAKGG
LRESFADPGLGYVDIPNAQIRKVTANRLLASKQTIPHYYLTVDARVDKLVQLRGELNPLQ
DASGGKKISINDLVIKAAALALRKVPQCNSSWMNDFIRQYHNVNINVAVQTEHGLFVPVI
RDADKKGLGAIAEEVKQLAQKARDNSLKPADYEGGTFTVSNLGGPFGIKQFCAIINPPQS
AILAIGSAEKRVIPGSADGQFEFGSFMSATLSCDHRVIDGAIGAEFLKAFKGYIENPTSM
LL*

MPSLSPTMTEGNIAKWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDGAK
EIKVGEVIAITVEEEGDIEKFKDYKPSSSAEPVAPAESKAQPEPSQPKVEEKKLTQAPEV
KAPKIEEASQSGDRIFASPLARKLAEDNNVPLSSVKGTGPDGRILKADIEDYLAKGGLRE
AFAAPGLGYVDIPNAQIRKVTANRLLASKQTIPHYYLTVDARVDKLVKLRGELNPLQDAS
GGKKISINDLVIKAAALALRKVPQCNSSWMNDFIRQYHNVNINVAVQTEHGLFVPVIRDA
DKKGLGTIAEEVKQLAQKARDNSLKPADYEGGTFTISNLGGPFGIKQFCAIINPPQSAIL
AIGSAEKR*

Other information
Ka divergence:-0.561812KaKs divergence:-0.389387
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):1629Length 2 (bp):1107Length divergence:-0.191
MFE 1 (kcal):-533.25MFE 2 (kcal):-348.54MFE divergence-0.209